Recombinant Mycobacterium bovis ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mycobacterium bovis ATP Synthase Subunit b (atpF)

Recombinant Mycobacterium bovis ATP synthase subunit b (atpF) refers to a genetically engineered form of the atpF subunit of the ATP synthase enzyme derived from the Mycobacterium bovis bacterium . ATP synthase is an essential enzyme complex that produces adenosine triphosphate (ATP), the primary energy currency of cells . The atpF subunit, also known as subunit b, is a component of the ATP synthase complex .

In mycobacteria, including Mycobacterium bovis, ATP synthase is crucial for energy production and survival, making it a potential target for developing new anti-tuberculosis drugs . The recombinant form of the atpF subunit is produced using genetic engineering techniques, where the gene encoding the atpF subunit is inserted into a host organism (e.g., E. coli) to express and produce large quantities of the protein . The recombinant protein can then be purified and used for various research and development purposes .

Key Features and Characteristics

  • Origin: Derived from Mycobacterium bovis, a bacterium closely related to Mycobacterium tuberculosis, the causative agent of tuberculosis .

  • Function: It is a subunit of the ATP synthase enzyme complex, essential for ATP production in mycobacteria .

  • Production: Produced through recombinant DNA technology, typically expressed in E. coli and purified for research use .

  • Structure: The b′ subunit is coded by atpF and represents the shorter version of the subunit without the C-terminus .

  • Sequence Similarity: High sequence similarity among different mycobacterial strains, making it a suitable target for drug development studies . For Mtb-H37Ra and M. bovis, the subunits displayed 98 to 100% sequence similarity, thus they act as excellent surrogates for studies conducted to identify drug targeting mycobacterial ATP synthase .

Role in ATP Synthase

ATP synthase is a multi-subunit enzyme complex responsible for synthesizing ATP from adenosine diphosphate (ADP) and inorganic phosphate (Pi) using the proton-motive force generated across the cell membrane . In mycobacteria, ATP synthase is vital for maintaining energy homeostasis and supporting essential cellular processes . The enzyme consists of two main functional domains:

  • F1 domain: Contains the catalytic sites for ATP synthesis and consists of multiple subunits, including α, β, γ, δ, and ε .

  • F0 domain: Embedded in the cell membrane and responsible for proton translocation, which drives the rotation of the c-ring and ultimately ATP synthesis. Subunit b (atpF) is a component of the F0 domain and plays a role in stabilizing the complex and connecting it to the F1 domain .

Research Applications

Recombinant Mycobacterium bovis ATP synthase subunit b (atpF) is a valuable tool in various research areas:

  • Drug Discovery: The mycobacterial ATP synthase is a validated drug target, with bedaquiline being an example of an ATP synthase inhibitor used to treat tuberculosis . The recombinant atpF subunit can be used to screen for and characterize new inhibitors of ATP synthase .

  • Structural Biology: The recombinant protein can be used to determine the structure of the atpF subunit and the entire ATP synthase complex, providing insights into the enzyme's mechanism of action and potential vulnerabilities .

  • Vaccine Development: The atpF subunit, along with other mycobacterial antigens, can be used to develop new vaccines against tuberculosis . Recombinant atpF can be used to study the immune response to this antigen and to design more effective vaccines .

  • Understanding Resistance Mechanisms: Studying the atpF subunit can help elucidate the mechanisms by which mycobacteria develop resistance to ATP synthase inhibitors like bedaquiline .

Significance as a Drug Target

ATP synthase is an attractive drug target in Mycobacterium tuberculosis due to its essential role in energy metabolism and the unique structural features that differentiate it from the host enzyme . Several inhibitors targeting ATP synthase have shown promising activity against M. tuberculosis, including bedaquiline . By targeting specific subunits like atpF, researchers aim to develop more selective and potent inhibitors that can disrupt ATP production and kill the bacteria .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
atpF; BCG_1366; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Target Names
atpF
Target Protein Sequence
MGEVSAIVLAASQAAEEGGESSNFLIPNGTFFVVLAIFLVVLAVIGTFVVPPILKVLRER DAMVAKTLADNKKSDEQFAAAQADYDEAMTEARVQASSLRDNARADGRKVIEDARVRAEQ QVASTLQTAHEQLKRERDAVELDLRAHVGTMSATLASRILGVDLTASAATR
Uniprot No.

Target Background

Function
F1F0 ATP synthase catalyzes ATP synthesis from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous F1 catalytic core and the membrane-embedded F0 proton channel, connected by a central and peripheral stalk. ATP synthesis in the F1 domain is coupled to proton translocation via the rotary mechanism of the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk that links F1 and F0.
Database Links

KEGG: mbb:BCG_1366

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Recombinant Mycobacterium bovis ATP synthase subunit b (atpF) and how does it relate to atpFH?

ATP synthase subunit b in Mycobacterium bovis is commonly referred to as atpF, while atpFH appears to be a fusion protein encompassing both subunit b and delta components of the ATP synthase complex. In the Mycobacterium genome, this protein is often annotated as "ATP synthase subunit b-delta" with gene names including atpFH or atpH . The recombinant form refers to the protein produced through heterologous expression systems rather than purified directly from M. bovis cells. This approach allows for higher yield and purity while avoiding the biosafety concerns associated with handling pathogenic mycobacteria.

What expression systems are most effective for producing recombinant M. bovis ATP synthase subunit b?

Multiple expression systems have proven effective for the recombinant production of M. bovis ATP synthase subunit b, each with distinct advantages depending on research requirements. Common host systems include E. coli, yeast, baculovirus-infected insect cells, and mammalian cell expression platforms . The table below compares these expression systems based on key parameters relevant to research applications:

Expression SystemYieldPost-translational ModificationsScale-up PotentialExpression TimeNative Folding Efficiency
E. coliHighLimitedExcellent1-2 daysModerate
YeastModerateYes (eukaryotic-like)Good3-4 daysGood
BaculovirusModerate-HighYes (complex)Moderate5-7 daysVery good
Mammalian CellLow-ModerateYes (mammalian)Limited7-14 daysExcellent

The selection of an appropriate expression system should be guided by specific experimental requirements, particularly when functional studies are planned. Standard purification typically achieves greater or equal to 85% purity as determined by SDS-PAGE regardless of the expression system employed .

How can researchers verify the identity and purity of recombinant ATP synthase subunit b?

Identity and purity verification of recombinant ATP synthase subunit b involves a multi-technique approach. SDS-PAGE analysis represents the minimum standard, with recombinant preparations typically achieving ≥85% purity . For more rigorous characterization, researchers should implement:

  • Western blotting with antibodies specific to ATP synthase subunit b

  • Mass spectrometry for precise molecular weight determination and peptide mapping

  • N-terminal sequencing to confirm the correct protein sequence

  • Size exclusion chromatography to assess homogeneity and aggregation state

For functional verification, ADP/ATP exchange assays following reconstitution into liposomes can provide confirmation of biochemical activity, though these require careful optimization of reconstitution conditions.

What is the functional significance of ATP synthase in M. bovis pathogenicity?

ATP synthase plays a dual role in M. bovis physiology and pathogenicity. Beyond its primary function in energy metabolism, several lines of evidence suggest its relevance to virulence and persistence:

  • ATP production via oxidative phosphorylation supports survival under variable host conditions

  • ATP synthase components have been identified as potential targets for anti-tuberculosis drugs

  • The enzyme complex may contribute to acid adaptation during host infection

  • ATP homeostasis influences bacterial persistence during dormancy phases

Notably, ATP synthase genes including atpE (which codes for ATP synthase subunit C) have proven useful as molecular targets for detecting mycobacteria at the genus level in diagnostic applications . This indicates the conserved nature and essential function of ATP synthase components across mycobacterial species.

What methodological approaches can be used to study ATP synthase function using recombinant subunits?

Studying ATP synthase function using recombinant subunits requires sophisticated biochemical and biophysical techniques, particularly for complex membrane proteins. Contemporary approaches include:

  • Liposome reconstitution systems: Recombinant ATP synthase subunits can be reconstituted into unilamellar liposomes to study their transport activity. This approach allows precise control of experimental conditions and directly measures protein-specific activity .

  • Fluorescence-based assays: Rather than relying on radioactively labeled substrates, fluorescence techniques using magnesium-sensitive dyes such as Magnesium Green (MgGr™) can detect ADP/ATP exchange by exploiting the different binding affinities of Mg²⁺ for ATP versus ADP . This method is particularly valuable for kinetic measurements.

  • Inhibitor studies: Function can be verified through inhibition assays using specific ATP synthase inhibitors. For proteins like adenine nucleotide translocase (ANT, functionally analogous in some respects), specific inhibitors like bongkrekic acid and carboxyatractyloside are used to confirm measurement specificity .

  • Real-time PCR for expression studies: While not directly measuring protein function, real-time PCR targeting ATP synthase genes (such as atpE) can quantify expression levels in different conditions, providing insights into regulation .

The fluorescence-based assays represent a particular methodological advancement, being more convenient than radioactive methods while still maintaining sensitivity and specificity for transport studies .

How can researchers overcome challenges in expressing functional ATP synthase subunits?

Expression of functional ATP synthase subunits presents several challenges that can be addressed through specific methodological approaches:

  • Membrane protein solubility issues:

    • Utilize fusion partners like MBP (maltose-binding protein) or SUMO to improve solubility

    • Optimize detergent selection during extraction and purification

    • Consider nanodiscs or amphipols for maintaining native-like membrane environments

  • Protein misfolding in heterologous systems:

    • Lower expression temperature (16-25°C) to slow folding and improve correctness

    • Co-express with mycobacterial chaperones when using E. coli systems

    • Consider cell-free expression systems for difficult proteins

  • Maintaining subunit associations:

    • Co-expression of interacting subunits may improve stability

    • Careful optimization of buffer conditions to maintain protein-protein interactions

    • Cross-linking approaches for stabilizing complex assemblies

  • Functional verification challenges:

    • Develop reconstitution protocols that maintain the native orientation in membranes

    • Establish functional assays that can detect activity of individual subunits versus the complete complex

    • Use comparative analyses with native ATP synthase to benchmark recombinant protein activity

What are the current methodological approaches for measuring ATP synthase activity in reconstituted systems?

Measuring ATP synthase activity in reconstituted systems has evolved beyond traditional radioactive assays to more accessible fluorescence-based techniques. A systematic approach involves:

  • Fluorescence-based ADP/ATP exchange assays: Using magnesium-sensitive fluorescent dyes like Magnesium Green™ to detect nucleotide exchange. This technique exploits the different binding affinities of Mg²⁺ for ATP versus ADP, allowing real-time monitoring of exchange activity. Studies with reconstituted proteins have demonstrated ADP/ATP exchange rates of approximately 3.49 ± 0.41 mmol/min/g for recombinant proteins like ANT1 .

  • Liposome-based proton gradient measurements: Using pH-sensitive fluorescent dyes to monitor proton translocation coupled to ATP synthesis/hydrolysis.

  • Direct ATP synthesis/hydrolysis measurement: Employing enzyme-coupled assays that link ATP production or consumption to spectrophotometrically detectable reactions.

  • Membrane potential assays: Using potential-sensitive dyes to monitor changes in membrane potential associated with ATP synthase activity.

The selection of the appropriate technique depends on which aspect of ATP synthase function is being investigated. For transport studies, the fluorescence-based methods offer advantages over radioactive assays in terms of safety, cost, and real-time measurement capabilities .

How do ATP synthase components from M. bovis contribute to molecular diagnostic methods?

ATP synthase components from M. bovis have significant utility in molecular diagnostic applications, particularly in distinguishing mycobacterial infections. Key methodological considerations include:

  • Real-time PCR targeting ATP synthase genes: The atpE gene, which codes for ATP synthase subunit C, has proven effective as a target for real-time PCR assays that can detect mycobacteria at the genus level with high sensitivity . This approach has demonstrated 100% detection rates from tissue samples and isolates, significantly outperforming traditional culture-based methods (p < 0.0001) .

  • Combined molecular approaches: The highest diagnostic accuracy is achieved by combining real-time PCR using ATP synthase gene targets (such as atpE) at the genus level with conventional PCR targeting different regions of difference (RDs) for species-level identification .

  • Integration with immunological detection: Flow cytometry evaluation of immune cell phenotypes (CD4+, CD8+, WC1+γδ, and CD2+) from infected cases can be combined with molecular detection of ATP synthase genes to improve diagnostic accuracy .

  • Analytical performance: When properly optimized, ATP synthase-based molecular detection methods demonstrate superior sensitivity and specificity compared to traditional tuberculin tests and mycobacterial isolation, which is extremely time-consuming .

This multifaceted approach offers significant advantages for bovine tuberculosis control strategies, potentially improving treatment efficacy evaluation and disease monitoring.

What structural insights can be gained from studying recombinant ATP synthase subunits compared to the native complex?

Comparative structural analysis between recombinant ATP synthase subunits and the native complex provides critical insights for both basic understanding and applied research:

  • Subunit-specific structural elements: Isolated recombinant subunits allow detailed examination of specific structural domains without interference from other components of the complex. For ATP synthase subunit b (atpF), this permits characterization of:

    • Membrane-spanning regions

    • Peripheral stalk interaction domains

    • Oligomerization interfaces

  • Conformational flexibility: Recombinant subunits may reveal conformational states not readily observable in the complete complex, particularly for components that undergo significant movement during the catalytic cycle.

  • Structure-function relationship studies: Site-directed mutagenesis combined with functional assays of recombinant subunits can map critical residues involved in:

    • Proton translocation

    • Subunit-subunit interactions

    • Energy transmission between domains

  • Species-specific structural adaptations: Comparison of ATP synthase subunits across different Mycobacterium species (M. bovis, M. tuberculosis, M. leprae, etc.) can highlight evolutionary adaptations that may correlate with pathogenicity or drug susceptibility .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.