Recombinant Mycobacterium bovis Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mycobacterium bovis Cobalamin Synthase (cobS)

Recombinant Mycobacterium bovis Cobalamin synthase (cobS) is a genetically engineered enzyme derived from Mycobacterium bovis, a bacterium closely related to Mycobacterium tuberculosis, the causative agent of tuberculosis. This enzyme is involved in the biosynthesis of cobalamin, also known as vitamin B12, which is crucial for various metabolic processes in bacteria and humans alike. The recombinant form of cobS is expressed in Escherichia coli and is typically fused with a His-tag for easier purification and identification .

Function and Importance of Cobalamin Synthase

Cobalamin synthase is part of the cobalamin biosynthesis pathway, which is essential for producing cobalamin. Cobalamin serves as a cofactor for several enzymes, including methionine synthase, which is involved in methionine biosynthesis. The ability to synthesize cobalamin is critical for bacterial survival and pathogenicity, especially in environments where cobalamin is scarce .

Recombinant Expression and Characteristics

The recombinant Mycobacterium bovis Cobalamin synthase (cobS) protein is a full-length enzyme consisting of 249 amino acids, expressed in E. coli with an N-terminal His-tag . This recombinant protein is used for studying cobalamin biosynthesis and its role in mycobacterial metabolism.

Characteristics of Recombinant Mycobacterium bovis Cobalamin Synthase (cobS)
Protein Length
Expression Host
Tag
Function

Future Directions

Future research on recombinant Mycobacterium bovis Cobalamin synthase (cobS) could focus on its role in modulating mycobacterial metabolism and its potential as a target for therapeutic interventions. Additionally, exploring how cobalamin biosynthesis impacts the virulence and survival of mycobacteria could lead to novel strategies for combating tuberculosis and other mycobacterial infections.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributor.
Note: All protein shipments are standard with blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on multiple factors, including storage conditions, buffer ingredients, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; BCG_2224; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Target Names
cobS
Target Protein Sequence
MMRSLATAFAFATVIPTPGSATTPMGRGPMTALPVVGAALGALAAAIAWAGAQVFGPSSP LSGMLTVAVLLVVTRGLHIDGVADTADGLGCYGPPQRALAVMRDGSTGPFGVAAVVLVIA LQGLAFATLTTVGIAGITLAVLSGRVTAVLVCRRSVPAAHGSTLGSRVAGTQPAPVVAAW LAVLLAVSVPAGPRPWQGPIAVLVAVTAGAALAAHCVHRFGGVTGDVLGSAIELSTTVSA VTLAGLARL
Uniprot No.

Target Background

Function
Cobalamin synthase (cobS) from *Mycobacterium bovis* catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: mbb:BCG_2224

Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (cobS) and what is its role in Mycobacterium bovis?

Cobalamin synthase (cobS) is an enzyme encoded by the cobS gene (Rv2208 in M. tuberculosis) that plays a critical role in the final stages of vitamin B12 (cobalamin) biosynthesis in mycobacteria. In Mycobacterium bovis, this enzyme participates in the aerobic pathway of cobalamin synthesis, specifically catalyzing the attachment of the lower ligand 5,6-dimethylbenzimidazole to the corrin ring structure. The enzyme is classified with the EC number 2.-.-.- indicating that its precise biochemical reaction mechanism is still under investigation . Expression studies have shown that cobS is actively expressed in various mycobacterial species, with expression levels varying depending on growth conditions and genetic background of the strain .

How does cobS structure relate to its function in cobalamin biosynthesis?

The structural analysis of Cobalamin synthase reveals a protein that belongs to a class of enzymes specialized in the final assembly of the complex cobalamin molecule. While the complete crystal structure of M. bovis cobS hasn't been fully characterized, comparative structural analyses with homologous proteins suggest that cobS contains specific domains essential for substrate binding and catalysis. The enzyme functions by facilitating the nucleotide loop assembly to the corrin ring structure, which is a critical step in generating functional cobalamin. This structural arrangement allows for the precise positioning of the 5,6-dimethylbenzimidazole moiety, which serves as the lower axial ligand to the cobalt ion in the completed cobalamin molecule . Understanding this structure-function relationship is crucial for interpreting experimental results in genetic manipulation studies.

How does recombinant Mycobacterium bovis cobS differ from the native enzyme?

Recombinant Mycobacterium bovis Cobalamin synthase produced in expression systems like yeast differs from the native enzyme in several important aspects. The recombinant protein typically contains only a partial sequence of the native enzyme, as indicated in commercial preparations . Additionally, differences in post-translational modifications may exist between the recombinant and native forms due to differences in the cellular machinery of the expression host. These modifications can affect protein folding, stability, and activity. The recombinant protein may also contain affinity tags or fusion partners that facilitate purification, though the specific tag type is often determined during the manufacturing process . Researchers should consider these differences when designing experiments that aim to extrapolate in vitro findings to in vivo contexts.

What are the optimal storage conditions for maintaining recombinant cobS activity?

For optimal preservation of recombinant Mycobacterium bovis Cobalamin synthase activity, storage conditions should be carefully controlled. According to manufacturer specifications, the shelf life of recombinant cobS is significantly influenced by storage state, buffer composition, temperature, and the inherent stability of the protein. The lyophilized form demonstrates greater stability, with a shelf life of approximately 12 months when stored at -20°C to -80°C. In contrast, the liquid form maintains stability for approximately 6 months under the same temperature conditions . To minimize activity loss due to protein degradation, repeated freeze-thaw cycles should be strictly avoided. For short-term research applications, working aliquots can be maintained at 4°C for up to one week without significant loss of activity . When creating aliquots for long-term storage, the addition of 5-50% glycerol (final concentration) is recommended to prevent freeze-damage to the protein structure.

How should recombinant cobS be reconstituted for experimental use?

The reconstitution of recombinant Mycobacterium bovis Cobalamin synthase requires specific methodological steps to ensure optimal activity recovery. Prior to opening, the vial containing lyophilized protein should be briefly centrifuged to collect the contents at the bottom, minimizing potential product loss. The recommended reconstitution protocol involves using deionized sterile water to achieve a final protein concentration of 0.1-1.0 mg/mL . For enhanced protein stability during storage of the reconstituted product, glycerol should be added to a final concentration between 5-50%, with 50% being the standard recommendation for prolonged storage periods. This glycerol addition provides cryoprotection and helps maintain protein conformation. The reconstituted protein solution should be thoroughly but gently mixed to ensure complete dissolution without causing protein denaturation through excessive mechanical stress .

What analytical methods are most effective for assessing cobS enzyme activity?

Multiple analytical approaches can be employed to assess the enzymatic activity of Cobalamin synthase, each with specific advantages for different research questions. Spectrophotometric assays that monitor the formation of the cobalamin product by measuring absorbance changes at specific wavelengths (typically around 360-370nm) can provide real-time kinetic data. Alternatively, high-performance liquid chromatography (HPLC) or mass spectrometry methods offer higher sensitivity for quantifying reaction products. For researchers focusing on structure-function relationships, coupling activity assays with site-directed mutagenesis experiments allows for the identification of critical residues involved in catalysis or substrate binding . RNA-Seq data analysis can be utilized to correlate cobS expression levels with observed enzymatic activity under various experimental conditions, as demonstrated in studies examining vitamin B12 synthesis across mycobacterial species . These methodological approaches should be selected based on the specific research question and available instrumentation.

How does cobS expression and function differ between M. bovis and M. tuberculosis?

The expression and function of Cobalamin synthase (cobS) exhibits significant differences between Mycobacterium bovis and Mycobacterium tuberculosis, despite their close phylogenetic relationship. RNA-Seq data analysis indicates that while the cobS gene is actively expressed in both species, the functional outcomes differ substantially. In M. bovis, expression of cobS contributes to functional vitamin B12 synthesis, with detectable levels of cobalamin found in cell lysates . In stark contrast, M. tuberculosis expresses the cobS gene (Rv2208) but remarkably fails to produce detectable levels of vitamin B12, suggesting potential post-transcriptional regulation or enzymatic dysfunction . The specific expression levels of cobS have been quantified across different growth conditions, with M. tuberculosis H37Rv showing expression values of 280.73 (±5.75) under normal conditions and 38.15 (±35.53) under low-potassium conditions, while expression reaches 228.80 (±323.58) during persistence . These expression patterns suggest evolution-driven adaptations in the cobalamin synthesis pathway between these closely related pathogens.

What evolutionary insights can be derived from studying cobS across the Mycobacterium tuberculosis Complex?

Comparative genomic and functional analysis of the cobS gene across the Mycobacterium tuberculosis Complex (MTBC) reveals compelling evolutionary insights into pathogen adaptation. Research demonstrates that MTBC members, including M. tuberculosis, M. africanum, and animal-adapted lineages, have undergone a distinct genomic decay of cobalamin biosynthetic genes, while environmental and opportunistic mycobacteria retain fully functional pathways . This evolutionary divergence appears to be a strategic adaptation for obligate pathogenicity, as MTBC members have shifted from autonomous vitamin B12 production to dependency on host-derived cobalamin. The retention of the cobS gene despite this functional shift suggests selective pressure to maintain the gene, possibly for its role in alternative metabolic pathways or its potential for regaining function under specific conditions . This evolutionary pattern aligns with broader observations of genome reduction in obligate pathogens and provides insights into the metabolic adaptations that facilitate successful host colonization by mycobacterial pathogens.

How does cobS functionality correlate with virulence across mycobacterial species?

The relationship between Cobalamin synthase functionality and virulence represents a complex interplay of metabolic adaptation and host-pathogen interactions across mycobacterial species. Experimental evidence indicates that environmental mycobacteria with functional cobS and complete vitamin B12 biosynthesis pathways typically demonstrate lower virulence in mammalian hosts compared to M. tuberculosis Complex members . Paradoxically, while M. tuberculosis lacks endogenous cobalamin production despite expressing cobS, it has evolved sophisticated mechanisms to exploit host vitamin B12 through exogenous uptake, which directly influences its virulence potential . Mouse infection models comparing vitamin B12 anemic conditions versus normal B12 levels demonstrate that MTBC strains show attenuated virulence in B12-deficient hosts, whereas ancestral mycobacteria with functional cobalamin synthesis (like M. canettii) remain equally virulent regardless of host B12 status . This correlation suggests that the evolutionary loss of autonomous B12 production, including functional cobS activity, represents a specialized adaptation that optimizes pathogen fitness within the host environment by creating dependency on host metabolites.

How can site-directed mutagenesis of recombinant cobS advance our understanding of cobalamin biosynthesis in mycobacteria?

Site-directed mutagenesis of recombinant Mycobacterium bovis Cobalamin synthase presents a powerful approach for elucidating the molecular mechanisms of cobalamin biosynthesis in mycobacteria. By systematically altering specific amino acid residues predicted to be involved in substrate binding or catalysis, researchers can establish structure-function relationships within the enzyme. Particularly valuable targets include conserved motifs identified through comparative sequence analysis across mycobacterial species. Experimental approaches should include expression of mutant cobS variants in heterologous systems, followed by in vitro activity assays using HPLC or mass spectrometry to quantify reaction products . Complementation studies in cobS-deficient strains can further validate the functional significance of specific residues in vivo. This methodological approach has potential to identify critical catalytic residues that could explain the functional differences observed between cobS in M. bovis versus M. tuberculosis, providing insights into the evolutionary adaptation of the cobalamin biosynthesis pathway in pathogenic mycobacteria.

What are the methodological approaches for investigating cobS interactions with other proteins in the cobalamin biosynthesis pathway?

Investigation of protein-protein interactions involving Cobalamin synthase requires sophisticated methodological approaches to capture both stable and transient interactions within the cobalamin biosynthesis pathway. Co-immunoprecipitation coupled with mass spectrometry represents a robust initial approach for identifying interaction partners of recombinant cobS. For validation and quantification of specific interactions, researchers should employ techniques such as surface plasmon resonance (SPR) or microscale thermophoresis (MST), which provide kinetic and thermodynamic parameters of binding events. Bacterial two-hybrid systems and fluorescence resonance energy transfer (FRET) assays offer powerful in vivo approaches to confirm interactions in a cellular context . Structural studies using X-ray crystallography or cryo-electron microscopy of cobS in complex with interaction partners can provide atomic-level insights into the molecular mechanism of cooperation between cobalamin synthesis enzymes. Methodologically, these approaches should be complemented with gene co-expression analysis using RNA-Seq data to identify potential interaction partners based on synchronized expression patterns across various growth conditions .

How can recombinant cobS be used to develop inhibitors for targeting mycobacterial cobalamin biosynthesis?

The development of inhibitors targeting mycobacterial Cobalamin synthase represents an innovative approach for therapeutic intervention, particularly for non-tuberculous mycobacteria (NTM) that rely on endogenous vitamin B12 production. Methodologically, this research direction requires a pipeline incorporating structure-based drug design using computational methods to identify potential binding sites on the recombinant cobS protein. Virtual screening of compound libraries can generate initial hit compounds, which should then undergo biochemical validation using in vitro enzyme inhibition assays. Thermal shift assays can confirm direct binding of compounds to the recombinant protein. Lead compounds demonstrating inhibitory activity should be evaluated in whole-cell assays against various mycobacterial species to assess cellular penetration and specific growth inhibition . Importantly, differential inhibition profiles between species with functional cobS (like M. bovis) versus those lacking functional cobalamin biosynthesis (like M. tuberculosis) can provide validation of the specific targeting mechanism. This methodological approach has particular relevance for developing targeted therapies against emerging NTM infections while potentially sparing human commensal bacteria that utilize different cobalamin biosynthesis pathways.

What are the contradictions in current literature regarding cobS functionality in the Mycobacterium tuberculosis Complex?

Analysis of the current literature reveals several significant contradictions regarding cobS functionality in the Mycobacterium tuberculosis Complex that require methodological resolution. The paradoxical observation that M. tuberculosis expresses the cobS gene (Rv2208) at levels comparable to or higher than other mycobacteria (280.73 ±5.75 under normal conditions), yet fails to produce detectable vitamin B12, presents a fundamental contradiction . Some studies report the presence of vitamin B12 in M. bovis BCG using microbiological assays, while more recent immunoassay-based detection methods failed to detect cobalamin in M. tuberculosis H37Rv under various growth conditions . Additionally, conflicting reports exist regarding strain-specific differences, with some studies suggesting the clinical M. tuberculosis strain CDC1551 may retain cobalamin synthesis capability compared to H37Rv . These contradictions might stem from methodological differences in detection sensitivity, growth conditions affecting gene expression, or post-transcriptional regulatory mechanisms. Future research should resolve these contradictions through standardized quantitative approaches combining transcriptomics, proteomics, and metabolomics across multiple strains under identical experimental conditions.

What research directions could exploit the differential dependency on cobS functionality between pathogenic and non-pathogenic mycobacteria?

The differential dependency on Cobalamin synthase functionality between pathogenic and non-pathogenic mycobacteria opens several promising research directions with significant therapeutic implications. One methodological approach involves developing selective growth inhibitors targeting cobS or other cobalamin biosynthesis enzymes that would specifically affect non-tuberculous mycobacteria (NTM) while having minimal impact on M. tuberculosis, which relies on host vitamin B12 . Conversely, strategies to restrict host vitamin B12 availability could selectively impair M. tuberculosis growth while allowing commensal bacteria with endogenous cobalamin synthesis to thrive. Experimental approaches should include comparative metabolomic profiling of pathogenic versus non-pathogenic mycobacteria under vitamin B12 limitation to identify species-specific metabolic vulnerabilities. The development of conditional knockout systems for cobS in various mycobacterial species would enable precise determination of its essentiality across different growth conditions and infection models . From a host-pathogen interaction perspective, investigating how M. tuberculosis regulates gene expression in response to varying host vitamin B12 levels could identify novel drug targets that disrupt this adaptive response. These research directions collectively exploit the evolutionary divergence in cobalamin metabolism as a potential therapeutic vulnerability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.