Recombinant Mycobacterium bovis Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mycobacterium bovis Fumarate Reductase Subunit D (frdD)

Recombinant Mycobacterium bovis Fumarate reductase subunit D (frdD) is a protein produced through recombinant DNA technology. This protein is part of the fumarate reductase complex, which plays a crucial role in the metabolic pathways of mycobacteria. The fumarate reductase complex is involved in the electron transport chain and is essential for the survival of these bacteria under anaerobic conditions.

Production and Characteristics

The recombinant frdD protein is typically produced in an Escherichia coli expression system, which allows for high purity and yield. This method involves cloning the gene encoding frdD into a plasmid, followed by transformation into E. coli cells, where the protein is expressed and purified .

Biological Significance:

  • Metabolic Pathways: Essential for anaerobic respiration and energy production.

  • Drug Target: The fumarate reductase complex, including frdD, is considered a potential drug target due to its role in mycobacterial metabolism .

Research Findings and Applications

Research on the fumarate reductase complex, including frdD, has focused on understanding its metabolic role and potential as a drug target. Studies have shown that this complex may have evolved to perform additional functions beyond its primary metabolic role, particularly in the interaction between mycobacteria and their host cells .

Research Highlights:

  • Evolutionary Adaptations: The fumarate reductase operon has evolved differently in M. bovis compared to M. tuberculosis, suggesting adaptive responses to environmental pressures .

  • Drug Development: The complex is a potential target for drug design, although its redundancy with other metabolic pathways complicates this approach .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. Please specify your required tag type for preferential development.
Synonyms
frdD; JTY_1581; Fumarate reductase subunit D; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
Target Names
frdD
Target Protein Sequence
MTPSTSDARSRRRSAEPFLWLLFSAGGMVTALVAPVLLLLFGLAFPLGWLDAPDHGHLLA MVRNPITKLVVLVLVVLALFHAAHRFRFVLDHGLQLGRFDRVIALWCYGMAVLGSATAGW MLLTM
Uniprot No.

Target Background

Function
This protein anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones.
Database Links

KEGG: mbt:JTY_1581

Protein Families
FrdD family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.