Recombinant Mycobacterium bovis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mycobacterium bovis Large-Conductance Mechanosensitive Channel (MscL)

The large-conductance mechanosensitive channel (MscL) from Mycobacterium bovis is a protein that functions as a safety valve, opening in response to osmotic stress to release cytoplasmic solutes . Inappropriate opening of the MscL pore can harm the bacterial cell, making it a potential target for antibiotics .

Structure and Function

MscL has a large pore, capable of passing molecules up to 30 Å, which is the largest of any gated channel . The channel's structure includes an α-helix that interacts with a neighboring subunit along the cytoplasmic membrane; similar motifs have been seen in other prokaryotic and eukaryotic channels .

MscL as an Antibiotic Target

MscL's role as a potential antibiotic target is based on the idea that forcing the channel to open can disrupt bacterial cell function . Research has identified compounds that bind to and modulate MscL, slowing bacterial growth . One such compound, 011A, increases the sensitivity of various bacterial species to its effects, leading to slowed growth and decreased viability . Additionally, 011A can increase the potency of common antibiotics .

Research Findings and Data

  • Studies on MscL Modulation: Experiments using compounds like 011 and 120 have demonstrated increased MscL gating at the single-channel level . For example, Eco-MscL channel activity significantly increased when compound 011 was presented from either the periplasmic or cytoplasmic side of the membrane .

  • Impact on Bacterial Load: Research indicates that recombinant vaccines, such as rBCG-CMX, can reduce bacterial load in животные . Immunization with rBCG-CMX resulted in a significantly lower bacterial load in the lungs of mice compared to unimmunized mice .

  • Immune Response: The addition of recombinant fusion proteins like CMX to BCG Moreau can generate vaccines with improved immunological properties, inducing a balanced IFN-γ and IL17 cytokine response from CD4+ T cells and protecting mice from M. tuberculosis .

MscL and Vaccine Development

Recombinant Mycobacterium bovis strains, such as rBCG-mIL-18, have shown promise in inducing Th1 immune responses . The development of recombinant proteins is a potential avenue for creating effective vaccines against bovine tuberculosis (bTB) .

Mechanosensitive Channel Activation

Molecular docking, mutagenesis, and studies of orthologues suggest that compounds like SCH-79797 activate MscL by binding to a specific site at the interface between subunits in the cytoplasmic-membrane region of the protein .

Examples of MscL's impact

  • Mice immunized with rBCG-CMX showed a significant reduction in lung bacterial load compared to unimmunized mice . Boosting with rCMX further reduced the bacterial load .

  • Lungs of mice vaccinated with rBCG-CMX had larger preserved areas with little inflammatory infiltration, and very few necrotic foci, which are typically favorable for bacilli replication .

  • No foamy macrophages, known bacilli reservoirs, were found in the lungs of mice vaccinated with the recombinant vaccine .

Table: Effects of Immunization on Bacterial Load in Mice Lungs

GroupTreatmentLung Bacterial Load (CFU)
ControlUnimmunizedHigh
BCG MoreauImmunized with BCG MoreauLower than control
rBCG-CMXImmunized with rBCG-CMXSignificantly lower
rBCG-CMX + rCMXBoosted with rCMX after rBCG-CMX immunizationLowest

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
mscL; BCG_1040c; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Target Names
mscL
Target Protein Sequence
MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQSDVGILRIG IGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIRDL LAQTNGDSPGRHGGRGTPSPTDGPLASTESQ
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the MscL protein and what is its function in Mycobacterium bovis?

MscL (Large-conductance mechanosensitive channel) is an ion channel protein that opens in response to stretch forces in the membrane lipid bilayer. In Mycobacterium bovis and related mycobacteria, this channel likely plays a crucial role in regulating osmotic pressure changes within the bacterial cell . The protein belongs to the MscL family and functions as an integral membrane protein. Structurally, the MscL protein in M. tuberculosis H37Rv (highly homologous to M. bovis) consists of 151 amino acids and is encoded by the Rv0985c gene .

The channel's primary function involves sensing mechanical tension in the lipid bilayer and opening in response to this stimulus, allowing ions and small molecules to pass through. This mechanism helps protect bacterial cells from lysis during osmotic downshock by releasing intracellular pressure through the controlled release of cytoplasmic contents.

How conserved is MscL across different mycobacterial species?

The MscL protein demonstrates significant conservation across mycobacterial species. Analysis of sequence homology reveals that the M. tuberculosis H37Rv MscL (Rv0985c) shares approximately 71.0% identity in a 155 amino acid overlap with the putative mechanosensitive channel protein from Mycobacterium leprae . This high degree of conservation suggests functional importance across the Mycobacterium genus.

Beyond mycobacteria, the MscL protein shares homology with mechanosensitive channels in diverse bacterial species, including Streptococcus pyogenes (showing shared homology in a 120 amino acid protein), Streptomyces coelicolor (156 aa), Clostridium histolyticum (133 aa), Bacillus subtilis (130 aa, with 39.0% identity in 136 aa overlap), and Escherichia coli strain K-12 (136 aa, with 36.6% identity in 134 aa overlap) . This conservation across diverse bacterial taxa highlights the evolutionary significance of this membrane channel.

What expression systems are most effective for producing recombinant M. bovis MscL?

For the expression of recombinant M. bovis MscL, E. coli-based expression systems have proven particularly effective. The methodology typically involves:

  • Gene cloning: The MscL gene (equivalent to Rv0985c in M. tuberculosis) is amplified from M. bovis genomic DNA using PCR with specific primers containing appropriate restriction sites.

  • Vector construction: The amplified gene is cloned into expression vectors such as pET series vectors (particularly pET28a) that provide:

    • Strong inducible promoters (T7)

    • Fusion tags (His6, GST, or MBP) to facilitate purification

    • Appropriate antibiotic resistance markers

  • Expression conditions: Optimal expression typically involves:

    • Transformation into E. coli expression strains (BL21(DE3), C41(DE3), or C43(DE3))

    • Induction at mid-log phase (OD600 of 0.6-0.8) with IPTG (0.5-1 mM)

    • Post-induction growth at lower temperatures (16-25°C) for 4-16 hours to enhance proper folding

The use of specialized E. coli strains designed for membrane protein expression (such as C41(DE3) and C43(DE3)) often improves yields significantly compared to standard BL21(DE3) strains.

What are the critical challenges in purifying functional recombinant M. bovis MscL?

Purification of functional recombinant M. bovis MscL presents several critical challenges:

  • Membrane protein solubilization: As an integral membrane protein, MscL requires careful solubilization from the membrane using appropriate detergents. Common effective detergents include:

    • n-Dodecyl β-D-maltoside (DDM)

    • n-Octyl β-D-glucopyranoside (OG)

    • Lauryldimethylamine oxide (LDAO)

  • Maintaining protein stability: The stability of MscL during purification requires:

    • Consistent detergent concentration above critical micelle concentration (CMC)

    • Buffer optimization (typically pH 7.0-8.0 with 100-300 mM NaCl)

    • Addition of glycerol (5-10%) to enhance stability

    • Conducting purification steps at 4°C

  • Preventing aggregation: MscL tends to aggregate during concentration steps, which can be minimized by:

    • Using mild detergents

    • Including stabilizing agents like glycerol

    • Avoiding excessive protein concentration (>5 mg/ml)

  • Verifying functionality: Ensuring that purified MscL retains its native conformation and channel activity requires functional assays such as:

    • Reconstitution into liposomes for electrophysiology measurements

    • Fluorescence-based flux assays

    • EPR spectroscopy to examine conformational states

These challenges highlight the importance of optimizing each step of the purification protocol to obtain functional recombinant MscL protein suitable for structural and functional studies.

What detergent and lipid conditions are optimal for maintaining M. bovis MscL stability and activity?

The optimal detergent and lipid conditions for maintaining M. bovis MscL stability and activity include:

  • Detergent selection:

    • Primary extraction: Stronger detergents like Triton X-114 have been used successfully to extract membrane proteins from mycobacteria, including M. tuberculosis H37Rv

    • Purification: Milder detergents are preferred for maintaining stability during purification:

      • n-Dodecyl β-D-maltoside (DDM): 0.02-0.05% (w/v)

      • Lauryldimethylamine oxide (LDAO): 0.05-0.1% (w/v)

  • Lipid supplementation during purification:

    • Addition of E. coli polar lipid extract (0.01-0.02 mg/ml) to purification buffers

    • Supplementation with specific phospholipids like POPC (1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine) at 0.1-0.5 mM

  • Reconstitution conditions:

    • Lipid composition: Mixtures containing POPC, POPE (1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine), and cholesterol in ratios that mimic bacterial membranes

    • Lipid-to-protein ratio: Optimal ratios typically range from 100:1 to 400:1 (w/w)

    • Reconstitution method: Detergent removal via dialysis or bio-beads has proven effective

  • Buffer conditions for stability:

    • pH range: 7.0-8.0 (typically HEPES or Tris buffer systems)

    • Salt concentration: 150-300 mM NaCl or KCl

    • Additives: 5-10% glycerol, 1-5 mM dithiothreitol (DTT)

These optimal conditions have been established through various structural and functional studies of MscL proteins, with the goal of maintaining the native conformation and mechanosensitive properties of the channel.

What structural features distinguish M. bovis MscL from other bacterial mechanosensitive channels?

M. bovis MscL shares high homology with M. tuberculosis MscL, which has been structurally characterized. Key structural features that distinguish mycobacterial MscL from other bacterial mechanosensitive channels include:

These structural distinctions likely reflect adaptations to the unique cell envelope of mycobacteria and may contribute to differences in channel gating properties and physiological functions .

What methodologies can accurately assess the gating properties of recombinant M. bovis MscL?

Accurately assessing the gating properties of recombinant M. bovis MscL requires specialized methodologies that can measure channel activity in response to membrane tension. The following approaches have proven effective:

  • Patch-clamp electrophysiology:

    • Giant spheroplast patch-clamp: Recording channel activity from bacterial spheroplasts expressing MscL

    • Reconstituted patch-clamp: Recording from proteoliposomes containing purified MscL

    • Planar lipid bilayer: Incorporating purified MscL into artificial membranes

    • Key measurements: Single-channel conductance, threshold tension for activation, open probability, subconductance states, and gating kinetics

  • Fluorescence-based flux assays:

    • Liposome-reconstituted MscL loaded with self-quenching fluorescent dyes (calcein, carboxyfluorescein)

    • Measurement of fluorescence dequenching upon channel opening in response to osmotic downshock or amphipaths

    • Allows high-throughput screening of channel activity under various conditions

  • FRET-based conformational sensors:

    • Introduction of fluorescent protein pairs or small-molecule fluorophores at strategic positions

    • Measurement of FRET efficiency changes during channel gating

    • Provides real-time information on conformational changes

  • Molecular dynamics simulations:

    • All-atom or coarse-grained simulations of MscL embedded in lipid bilayers

    • Application of lateral tension to mimic membrane stretch

    • Analysis of pore dynamics, water/ion permeation, and protein-lipid interactions

Studies have employed these methodologies to investigate structural determinants of MscL gating through molecular dynamics simulations and mutational analyses of the M. tuberculosis MscL channel .

How do lipid composition and membrane properties affect M. bovis MscL gating behavior?

The lipid composition and membrane properties significantly influence M. bovis MscL gating behavior through several mechanisms:

  • Bilayer thickness effects:

    • Channel gating threshold decreases in thinner membranes

    • Hydrophobic mismatch between protein and lipid bilayer creates tension that facilitates channel opening

    • Quantitative relationship: Approximately 10-15% decrease in gating tension for each 2Å reduction in bilayer thickness

  • Lipid headgroup interactions:

    • Negatively charged lipids (e.g., phosphatidylglycerol, cardiolipin) lower the gating threshold

    • Interaction with positively charged residues at the cytoplasmic membrane interface stabilizes the open state

    • Effect is concentration-dependent: 20-30% mole fraction of negatively charged lipids optimal for lowering gating threshold

  • Membrane lateral pressure profile:

    • Cone-shaped lipids (PE) increase lateral pressure in the acyl chain region, raising gating threshold

    • Inverted cone-shaped lipids (lysolipids) decrease lateral pressure in the acyl chain region, lowering gating threshold

    • Cholesterol and other sterols increase membrane rigidity and raise gating threshold

  • Fatty acid composition:

    • Unsaturated fatty acids increase membrane fluidity and lower gating threshold

    • Chain length affects hydrophobic matching with the channel's transmembrane domains

    • Branched-chain fatty acids, common in mycobacteria, may provide specific modulation of MscL function

Understanding these lipid-protein interactions is crucial for accurately characterizing MscL function in the native mycobacterial membrane environment, which contains unique lipids such as mycolic acids that may specially tune channel properties.

How can site-directed mutagenesis of M. bovis MscL inform structure-function relationships?

Site-directed mutagenesis of M. bovis MscL offers powerful insights into structure-function relationships through systematic modification of key residues. A methodological approach includes:

  • Strategic target selection:

    • Pore-lining residues (particularly in TM1): Mutations affect conductance, ion selectivity, and hydrophobic gating

    • Tension-sensing residues at membrane interfaces: Mutations alter gating threshold and sensitivity

    • Intersubunit contacts: Mutations affect channel stability and cooperative gating

    • Cytoplasmic domain residues: Mutations influence channel inactivation and adaptation

  • Mutation design strategies:

    • Conservative substitutions (e.g., L→I, D→E): Assess subtle structural requirements

    • Charge reversals (e.g., K→E, D→K): Probe electrostatic interactions

    • Hydrophobicity alterations (e.g., L→N, V→D): Examine hydrophobic gating mechanism

    • Cysteine substitutions: Enable disulfide crosslinking and chemical modification studies

    • Incorporation of unnatural amino acids: Introduce spectroscopic probes or photo-crosslinkers

  • Functional assessment of mutants:

    • Electrophysiological characterization: Patch-clamp analysis of gating threshold, kinetics, conductance

    • Fluorescence-based assays: High-throughput screening of mutant function

    • Structural analysis: Crystallography or cryo-EM of key mutants to capture conformational changes

    • In vivo phenotypic analysis: Osmotic shock survival rates

Previous studies have used similar approaches with M. tuberculosis MscL to identify gain-of-function mutations in the loop region and to study structural determinants of gating, as indicated by multiple papers cited in the bibliography .

What experimental approaches can differentiate between the roles of MscL in osmotic regulation versus potential roles in pathogenesis?

Differentiating between MscL's roles in osmotic regulation and potential roles in pathogenesis requires multi-faceted experimental approaches:

  • Gene knockout and complementation studies:

    • Generation of MscL deletion mutants in M. bovis

    • Complementation with wild-type or modified MscL variants

    • Assessment of:

      • Osmotic shock survival

      • Virulence in cellular and animal models

      • Persistence under stress conditions

    • Note: MscL has been identified as non-essential for in vitro growth of M. tuberculosis H37Rv through multiple transposon mutagenesis studies , suggesting potential redundancy or specialized roles

  • Infection models with MscL variants:

    • Macrophage infection assays with wild-type vs. MscL-deficient strains

    • Animal models (typically mice or guinea pigs) to assess:

      • Bacterial burden in tissues

      • Tissue pathology

      • Survival rates

      • Immune response profiles (cytokine production, granuloma formation)

  • Stress response analysis:

    • Transcriptomic and proteomic profiling of wild-type vs. MscL-deficient strains under:

      • Osmotic stress conditions

      • Phagosomal environment mimics (low pH, oxidative stress, nutrient limitation)

      • Antibiotic exposure

    • Measurement of MscL expression levels during different infection stages

  • Host-pathogen interaction studies:

    • Assessment of MscL's potential role in:

      • Resistance to antimicrobial peptides

      • Phagosomal escape or survival

      • Modulation of host immune responses, particularly production of TNF-α and IL-1β, which have been shown to be stimulated by other M. bovis proteins

These approaches can help determine whether MscL primarily functions in basic bacterial physiology (osmotic regulation) or plays additional roles in virulence, persistence, or immune modulation during infection.

How can recombinant M. bovis MscL be utilized in drug discovery platforms?

Recombinant M. bovis MscL offers several promising applications in drug discovery platforms:

  • High-throughput screening assays:

    • Liposome-based fluorescence assays:

      • MscL reconstituted into liposomes loaded with self-quenching fluorescent dyes

      • Compound libraries screened for molecules that:
        a) Activate MscL (causing dye release and fluorescence increase)
        b) Inhibit MscL (preventing dye release during osmotic downshock)

      • Quantification via plate reader for rapid screening of thousands of compounds

  • Structure-based drug design:

    • In silico screening using crystal structure data and molecular docking

    • Virtual screening focused on:

      • The channel pore region

      • Tension-sensing interfaces

      • Subunit interaction surfaces

    • Molecular dynamics simulations to predict compound effects on channel gating

  • Fragment-based drug discovery:

    • Screening of fragment libraries using:

      • Thermal shift assays (differential scanning fluorimetry)

      • NMR-based fragment screening

      • Surface plasmon resonance (SPR)

    • Identification of binding sites and fragment growing/linking strategies

  • Phenotypic screening platforms:

    • Bacterial survival assays under osmotic stress with wild-type and MscL-deficient strains

    • Macrophage infection models to identify compounds that specifically target MscL-dependent processes

  • Validation methodologies:

    • Site-directed mutagenesis of predicted binding sites

    • Competition binding assays

    • Electrophysiological confirmation of compound effects on channel function

    • Crystallography or cryo-EM to confirm binding modes

This approach leverages the unique properties of MscL as a druggable target, as its essential role in bacterial survival under certain stress conditions and its absence in mammalian cells make it an attractive candidate for selective antimicrobial development.

How might the unique mycobacterial cell wall influence MscL function compared to other bacterial species?

The distinctive mycobacterial cell wall architecture significantly impacts MscL function through multiple mechanisms:

  • Altered membrane tension sensing:

    • The mycobacterial plasma membrane is surrounded by a thick peptidoglycan layer and an outer membrane composed of mycolic acids

    • This complex envelope may buffer mechanical forces, requiring:

      • Different tension thresholds for activation

      • Modified gating kinetics to respond appropriately

      • Specialized tension-sensing domains

  • Lipid environment effects:

    • Mycobacterial membranes contain unique lipids, including:

      • Trehalose dimycolate (cord factor)

      • Phosphatidylinositol mannosides (PIMs)

      • Phenolic glycolipids

    • These unique lipids create a different hydrophobic environment that may:

      • Alter the lateral pressure profile experienced by MscL

      • Modify hydrophobic mismatch between protein and lipid

      • Create specific lipid-protein interactions that tune channel function

  • Integration with cell envelope stress responses:

    • MscL function may be coordinated with cell wall remodeling enzymes

    • Potential interactions with:

      • Peptidoglycan biosynthesis machinery

      • Mycolic acid synthesis pathways

      • Cell division proteins

  • Protein-protein interactions:

    • The extended C-terminal domain of mycobacterial MscL may facilitate interactions with:

      • Other membrane proteins

      • Cell wall synthesis enzymes

      • Signaling proteins involved in stress responses

Experimental approaches to study these unique aspects include:

  • Reconstitution of MscL into native-like mycobacterial membrane extracts

  • Creation of spheroplasts with varying degrees of cell wall removal

  • Comparative analysis of MscL function in different membrane environments

  • Analysis of protein interaction networks specific to mycobacterial MscL

What insights can comparative studies between M. bovis and M. tuberculosis MscL provide regarding species-specific adaptations?

Comparative studies between M. bovis and M. tuberculosis MscL can reveal important insights into species-specific adaptations, with methodological approaches including:

  • Sequence-structure-function analysis:

    • Detailed sequence alignment to identify:

      • Conserved residues (likely essential for basic channel function)

      • Variable residues (potential species-specific adaptations)

      • Post-translational modification sites

    • Homology modeling to predict structural differences

    • Functional comparison through equivalent mutations in both proteins

  • Expression pattern differences:

    • Transcriptomic analysis to determine:

      • Baseline expression levels in different growth conditions

      • Induction patterns during stress responses

      • Co-expression with other genes

    • Proteomic analysis to confirm protein abundance across different conditions

    • Quantitative comparisons between species using:

      • RNA-seq

      • qRT-PCR

      • Western blotting with species-specific antibodies

  • Host-pathogen interaction differences:

    • Comparison of immune responses to each protein:

      • Cytokine production (TNF-α, IL-1β) in response to recombinant proteins

      • Toll-like receptor (TLR) activation, particularly TLR2

      • Activation of NF-κB and IRF-1 pathways

    • Differential roles in:

      • Host cell invasion

      • Intracellular survival

      • Granuloma formation

      • Latency and reactivation

  • Evolutionary analysis:

    • Phylogenetic analysis of MscL across mycobacterial species

    • Identification of selection pressures:

      • Positive selection (adaptive evolution)

      • Negative selection (conservation)

    • Correlation with host range and pathogenicity

These comparative approaches can provide insights into how closely related pathogens have adapted their mechanosensitive channels to their specific ecological niches and pathogenic lifestyles.

What challenges exist in correlating in vitro functional studies of recombinant MscL with its physiological role in intact M. bovis cells?

Correlating in vitro studies of recombinant MscL with its physiological role in intact M. bovis presents several significant challenges:

  • Membrane environment discrepancies:

    • In vitro reconstitution typically uses:

      • Simplified lipid compositions (POPC, POPE, etc.)

      • Absence of native mycobacterial lipids (mycolic acids, PIMs, etc.)

      • Different membrane thickness and curvature

    • These differences may alter:

      • Gating threshold and kinetics

      • Channel conductance and selectivity

      • Protein-lipid interactions crucial for function

  • Protein modification and interaction network absence:

    • Recombinant systems lack:

      • Native post-translational modifications

      • Protein interaction partners present in vivo

      • Potential regulation by small molecules or second messengers

    • Methodological approaches to address this include:

      • Pull-down assays to identify interaction partners

      • Crosslinking studies in native membranes

      • Metabolomic analysis to identify regulatory molecules

  • Technical challenges in measuring native MscL activity:

    • Difficulties in preparing viable mycobacterial spheroplasts for patch-clamp

    • Challenges in distinguishing MscL activity from other mechanosensitive channels

    • Limited tools for real-time monitoring of MscL function in living bacteria

    • Slow growth and genetic manipulation challenges with mycobacteria

  • Complex stress responses in vivo:

    • In living bacteria, MscL functions within integrated stress response networks

    • Multiple redundant or compensatory mechanisms may mask MscL-specific effects

    • Osmotic challenges in vivo are often complex and combined with other stresses

  • Methodological approaches to bridge the gap:

    • Development of fluorescent reporters to monitor MscL activity in live cells

    • Creation of minimal systems that gradually increase in complexity

    • Complementation studies with chimeric channels

    • Use of native membrane vesicles for functional studies

    • Development of spheroplast preparation protocols specific for mycobacteria

Addressing these challenges requires multidisciplinary approaches combining biophysics, molecular biology, and cellular microbiology to establish the physiological significance of observations made with recombinant proteins.

How can contradictory data regarding MscL function be reconciled when comparing different experimental systems?

Reconciling contradictory data regarding MscL function across different experimental systems requires systematic methodological approaches:

  • Standardization of experimental conditions:

    • Establish consensus protocols for:

      • Protein purification and quality control

      • Lipid composition and preparation

      • Buffer conditions and tension application methods

      • Data analysis and reporting

    • Create reference datasets using standardized conditions

    • Develop calibration standards for different techniques

  • Direct comparative analysis:

    • Side-by-side testing of:

      • Different expression systems (E. coli vs. mycobacterial)

      • Purification methods (detergent types, purification tags)

      • Reconstitution techniques (liposomes, nanodiscs, planar bilayers)

    • Statistical analysis of variability between systems

    • Meta-analysis of published data with standardized effect size calculations

  • Identification of system-specific variables:

    • Systematic investigation of factors that may explain discrepancies:

      • Membrane composition effects

      • Protein modifications or truncations

      • Presence of contaminants or interaction partners

      • Measurement techniques and their limitations

    • Control experiments isolating single variables

    • Development of mathematical models to account for system differences

  • Bridging techniques between systems:

    • Use of complementary methodologies:

      • Combine structural studies with functional assays

      • Correlate in vitro measurements with in vivo phenotypes

      • Apply both reductionist and systems-level approaches

    • Development of hybrid systems that combine aspects of different experimental setups

  • Critical evaluation of contradictory results:

    • Assessment of data quality and reproducibility

    • Consideration of biological variability vs. technical artifacts

    • Hypothesis development to explain seemingly contradictory results

    • Design of critical experiments to test competing hypotheses

This systematic approach can help resolve contradictions in data and build a more coherent understanding of MscL function across different experimental paradigms.

What emerging technologies might advance our understanding of M. bovis MscL structure and function?

Several cutting-edge technologies hold promise for advancing our understanding of M. bovis MscL:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy (cryo-EM):

      • Single-particle analysis to capture different conformational states

      • Time-resolved cryo-EM to visualize gating transitions

      • Subtomogram averaging of MscL in native membrane environments

    • Integrative structural biology:

      • Combining X-ray crystallography, cryo-EM, NMR, and computational modeling

      • Mass spectrometry-based protein footprinting

      • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

  • Advanced spectroscopic techniques:

    • Single-molecule FRET:

      • Real-time monitoring of conformational changes in individual channels

      • Detection of rarely populated intermediate states

      • Correlation of structural dynamics with functional outcomes

    • Solid-state NMR:

      • Site-specific structural information in native-like membranes

      • Detection of lipid-protein interactions

      • Measurement of dynamics on physiologically relevant timescales

  • Novel membrane mimetic systems:

    • Nanodiscs with controlled lipid composition

    • Cell-derived giant plasma membrane vesicles (GPMVs)

    • Droplet interface bilayers for high-throughput electrophysiology

    • 3D-printed artificial cells with controllable membrane properties

  • Advanced microscopy techniques:

    • Super-resolution microscopy (STORM, PALM, STED) to visualize:

      • MscL clustering and distribution in bacterial membranes

      • Co-localization with other membrane proteins

      • Changes in localization during osmotic challenges

    • Correlative light and electron microscopy (CLEM)

    • Atomic force microscopy combined with electrophysiology

  • Computational approaches:

    • Enhanced sampling molecular dynamics:

      • Metadynamics

      • Umbrella sampling

      • Replica exchange

    • Machine learning for analysis of:

      • Single-channel recordings

      • Structural transitions

      • Sequence-function relationships

    • Multiscale modeling combining quantum mechanics, molecular mechanics, and coarse-grained approaches

These emerging technologies, especially when used in combination, promise to provide unprecedented insights into MscL structure, dynamics, and function in increasingly native-like conditions.

How might differential expression patterns of MscL impact M. bovis pathogenesis and survival in different host microenvironments?

Understanding how differential expression patterns of MscL impact M. bovis pathogenesis requires sophisticated methodological approaches:

  • Spatiotemporal expression mapping:

    • Single-cell RNA sequencing of bacteria isolated from different:

      • Host cell types (macrophages, dendritic cells, neutrophils)

      • Tissue microenvironments (lung, lymph node, granuloma)

      • Disease stages (early infection, latency, reactivation)

    • Reporter strain construction:

      • Fluorescent protein fusions to monitor MscL expression

      • Destabilized reporters to capture dynamic regulation

      • Dual reporters to normalize for bacterial numbers and metabolic state

  • Environmental stress response profiling:

    • Transcriptomic and proteomic analysis under stresses relevant to host environments:

      • Hypoxia and nutrient limitation

      • Acidic pH and reactive oxygen/nitrogen species

      • Osmotic fluctuations

      • Antibiotic exposure

    • Correlation of expression patterns with:

      • Bacterial survival rates

      • Metabolic adaptations

      • Virulence factor expression

  • Genetic manipulation studies:

    • Construction of strains with:

      • Constitutive MscL expression

      • Inducible MscL expression

      • MscL under control of heterologous promoters

    • Assessment of phenotypic consequences in:

      • In vitro stress survival assays

      • Macrophage infection models

      • Animal infection models

  • Host response correlation:

    • Analysis of how MscL expression levels correlate with:

      • Induction of pro-inflammatory cytokines (TNF-α, IL-1β)

      • Activation of TLR2 and NF-κB signaling pathways

      • Granuloma formation and structure

      • Bacterial persistence and dissemination

These approaches can reveal how M. bovis modulates MscL expression as part of its adaptive strategy to survive and replicate within diverse host microenvironments, potentially identifying critical expression patterns associated with disease progression or latency.

What potential exists for targeting MscL in novel therapeutic strategies against M. bovis infections?

The potential for targeting MscL in novel therapeutic strategies against M. bovis infections involves several promising research directions:

  • Rational drug design targeting MscL:

    • Structure-based approaches focused on:

      • The channel pore to block ion conductance

      • Tension-sensing regions to alter gating threshold

      • Subunit interfaces to disrupt channel assembly

    • Potential compound classes:

      • Small molecules that lock the channel in open state (causing osmotic dysregulation)

      • Compounds that prevent channel opening (increasing susceptibility to osmotic shock)

      • Allosteric modulators that interfere with normal gating responses

  • Combination therapy strategies:

    • MscL inhibitors combined with:

      • Conventional antibiotics to enhance uptake or prevent efflux

      • Compounds that alter membrane properties

      • Osmotic stress-inducing agents

    • Synergistic effects through:

      • Increased bacterial membrane permeability

      • Prevention of adaptive responses to antibiotic-induced stress

      • Disruption of cell wall integrity

  • Immune modulation approaches:

    • Development of compounds that:

      • Prevent MscL-mediated immune evasion

      • Enhance recognition of MscL-exposing bacteria by immune cells

      • Block potential immunomodulatory effects of MscL

    • Assessment of impact on:

      • TLR2 activation and downstream signaling

      • Pro-inflammatory cytokine production (TNF-α, IL-1β)

      • NF-κB and IRF-1 activation

  • Methodological approaches for therapeutic development:

    • High-throughput screening platforms:

      • Liposome-based fluorescence assays

      • Bacterial reporter systems

      • Phenotypic survival screens

    • Validation cascades:

      • Biophysical confirmation of target engagement

      • In vitro efficacy in mycobacterial cultures

      • Ex vivo testing in infected macrophages

      • In vivo efficacy in animal models

    • Pharmacokinetic and toxicity assessments focusing on:

      • Bioavailability in tuberculosis lesions

      • Selectivity over human membrane proteins

      • Compatibility with current treatment regimens

While MscL was found to be non-essential for in vitro growth of M. tuberculosis H37Rv in several studies , its potential importance under specific stress conditions relevant to infection and its possible role in pathogenesis still make it a promising novel target for therapeutic intervention, particularly as part of combination strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.