Recombinant Mycobacterium bovis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Biochemical and Functional Overview

LspA is a type II signal peptidase (SPase II) responsible for cleaving N-terminal signal peptides from prolipoproteins after lipidation by lipoprotein diacylglyceryl transferase (Lgt) . This processing is indispensable for the maturation of lipoproteins, which are anchored to the bacterial cell wall and play roles in virulence, immune evasion, and host-pathogen interactions.

Key Features

PropertyDescriptionSource
Molecular Weight~24–27 kDa (varies with expression system)
Catalytic ActivityAspartic protease that cleaves signal peptides at the conserved lipobox motif
EssentialityCritical for lipoprotein maturation; deletion attenuates M. bovis virulence
Substrate SpecificityRecognizes [LVI][ASTVI][GAS]C motif in prolipoproteins

Recombinant Production Systems

LspA is expressed in heterologous systems to study its biochemistry or develop therapeutic/diagnostic tools.

Expression Platforms

Host SystemAdvantagesApplicationsSource
E. coliHigh yield, cost-effectiveEnzymatic assays, structural studies
Yeast/BaculovirusProper folding for functional studiesVaccine antigen production
Mammalian CellsNative post-translational modificationsStudies on immunogenicity

Recombinant LspA retains enzymatic activity, enabling studies on lipoprotein processing and TLR2 signaling .

Role in Mycobacterium bovis Pathogenesis

LspA-deficient M. bovis mutants exhibit reduced virulence and altered immune interactions:

Key Findings

  1. Attenuation in Animal Models:

    • ΔlspA mutants show 3–4 log reduction in CFU in mice, with minimal lung pathology or systemic spread .

    • Impaired TLR2 signaling reduces HIV infectivity of CD4+ T cells ex vivo .

  2. Lipoprotein Deficiency:

    • ΔlspA strains lack mature lipoproteins (e.g., LprF, LprH), disrupting cell wall integrity and immune modulation .

    • Triacylated lipoproteins (e.g., LppX) require LspA for signal peptide cleavage and N-acylation by Lnt .

Immunogenicity and Vaccine Potential

LspA and lipoproteins are immunodominant antigens, making them targets for vaccine development:

Vaccine Strategies

ApproachMechanismOutcomeSource
Recombinant BCGOverexpression of LspA or lipoproteinsEnhanced TLR2 signaling, boosted immunity
Subunit VaccinesRecombinant LspA as antigen (e.g., P27 protein)Recognition by cattle sera and PBMCs
Reverse VaccinologyHigh-throughput screening of M. bovis ORFsIdentification of 123 immunogenic proteins

Potential Drug Targets

  • LspA Inhibitors: Disrupting lipoprotein maturation could attenuate M. bovis virulence. Globomycin, a reversible Lsp inhibitor, has been used in mechanistic studies .

  • Biomarker Detection: Recombinant LspA may aid in diagnosing M. bovis infections through serological assays .

Research Challenges and Future Directions

  1. Structural Insights: Crystallography studies are needed to elucidate LspA’s active site and substrate interactions.

  2. Host-Pathogen Dynamics: Investigating LspA’s role in phagosome maturation arrest (observed in ΔlspA mutants despite attenuation) .

  3. Synthetic Biology: Engineering LspA variants for vaccine adjuvants or biotechnological applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
lspA; BCG_1591; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Target Names
lspA
Target Protein Sequence
MPDEPTGSADPLTSTEEAGGAGEPNAPAPPRRLRMLLSVAVVVLTLDIVTKVVAVQLLPP GQPVSIIGDTVTWTLVRNSGAAFSMATGYTWVLTLIATGVVVGIFWMGRRLVSPWWALGL GMILGGAMGNLVDRFFRAPGPLRGHVVDFLSVGWWPVFNVADPSVVGGAILLVILSIFGF DFDTVGRRHADGDTVGRRKADG
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links

KEGG: mbb:BCG_1591

Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of lipoprotein signal peptidase (lspA) in Mycobacterium species?

Lipoprotein signal peptidase (lspA) is an enzyme responsible for cleaving the signal peptide from precursor lipoproteins during their maturation process. This cleavage occurs after the lipoproteins are diacylated by the enzyme Lgt at a conserved cysteine residue within the lipobox motif. The mature lipoproteins are then anchored to the bacterial membrane via lipid modifications. In Mycobacterium species, these lipoproteins serve diverse roles, including contributing to cell wall integrity, nutrient acquisition, and immune evasion mechanisms .

In pathogenic mycobacteria such as M. tuberculosis and M. bovis, lspA-mediated maturation of lipoproteins is critical for maintaining virulence and immunoregulatory functions. Disruption of lspA activity leads to attenuation of bacterial growth in vivo without significantly affecting phagosome maturation arrest . This makes lspA a promising target for therapeutic interventions aimed at controlling tuberculosis.

How does lspA influence the immune response during Mycobacterium infection?

This paradoxical behavior suggests that lspA's role extends beyond immune modulation via TLR signaling pathways. It may also influence early phagosomal environments that restrict bacterial growth . Further research is required to elucidate the precise mechanisms by which lspA contributes to immune evasion.

What experimental techniques are used to study recombinant lspA activity?

Several experimental approaches have been employed to investigate recombinant lspA activity:

SDS-PAGE Gel-Shift Assay

This assay tracks molecular weight shifts resulting from lspA-mediated cleavage of signal peptides from precursor lipoproteins . For example, recombinant prepro inhibitors are first converted by Lgt into intermediate forms using lipid substrates such as dioleoylphosphatidylglycerol (DOPG). LspA then cleaves these intermediates, producing mature forms detectable as ~10 kDa shifts on SDS-PAGE gels.

Inhibition Studies

Specific inhibitors such as globomycin have been used to quantify lspA activity by measuring signal intensity changes in gel-shift assays . Computationally designed cyclic peptide inhibitors have also demonstrated efficacy in inhibiting lspA activity and bacterial growth.

Reverse Vaccinology

Recombinant expression systems employing E. coli or insect cells have been utilized to produce soluble forms of lspA for immunogenicity testing . These systems facilitate rapid purification and characterization of recombinant proteins.

How does lspA deficiency affect Mycobacterium virulence?

Studies on M. tuberculosis mutants deficient in lspA have shown that these strains exhibit severe attenuation despite retaining their ability to arrest phagosome maturation . This attenuation is likely due to impaired processing of lipoproteins essential for bacterial survival within host macrophages.

Interestingly, while lspA-deficient mutants fail to trigger robust TLR2-dependent immune responses, they still manage to evade lysosomal degradation through phagosome maturation arrest mechanisms similar to wild-type strains . These findings highlight the multifaceted role of lspA in virulence regulation.

What are the challenges associated with targeting lspA for therapeutic purposes?

Targeting lspA presents several challenges:

Structural Complexity

The enzyme's active site and substrate specificity must be thoroughly characterized to design effective inhibitors. Computational modeling has provided insights into potential binding sites but requires experimental validation .

Dual Role in Immunity

Lipoproteins processed by lspA serve dual roles: some promote protective immune responses while others aid bacterial survival through immune modulation . Therapeutic strategies must account for these opposing effects.

Resistance Development

Mycobacteria are prone to developing resistance against single-target therapies due to spontaneous mutations or selective pressures . Combination approaches targeting multiple pathways may be necessary.

Can recombinant lspA be used as a vaccine candidate?

Recombinant lspA has shown promise as a vaccine candidate in reverse vaccinology approaches aimed at combating bovine tuberculosis caused by M. bovis . By cloning and expressing open reading frames encoding potential vaccine antigens, researchers have identified several immunogenic proteins suitable for test immunizations.

What data contradictions exist regarding lspA's role in phagosome maturation?

One notable contradiction involves the observation that lspA-deficient mutants exhibit severe attenuation despite retaining their ability to arrest phagosome maturation . This finding challenges the assumption that phagosome maturation arrest is solely responsible for Mycobacterium survival within host macrophages.

Further investigation into early phagosomal environments and alternative growth restriction mechanisms is needed to resolve this contradiction .

How do computational methods contribute to studying lspA inhibitors?

Computational methods play a crucial role in designing inhibitors targeting lspA:

Molecular Docking

Docking simulations predict binding affinities between potential inhibitors and the enzyme's active site . These predictions guide the synthesis of compounds with optimized inhibitory properties.

Structure-Based Design

By analyzing crystal structures or homology models of lspA, researchers can identify conserved motifs critical for enzymatic activity .

In Silico Screening

High-throughput virtual screening enables rapid identification of lead compounds from large chemical libraries .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.