Recombinant Mycobacterium bovis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Role in Oxidative Phosphorylation

nuoK is integral to the NDH-1 complex, which in mycobacteria operates alongside NDH-2 (Ndh) dehydrogenases. While NDH-2 mediates most NADH oxidation, NDH-1 contributes to proton translocation and stress adaptation .

Key Findings:

  • Interaction with Rv3143: In Mycobacterium tuberculosis, the orphan response regulator Rv3143 binds NuoD (a NDH-1 subunit) and modulates NDH-1 activity. Mutants lacking Rv3143 or its ortholog (msmeg_2064 in M. smegmatis) show reduced growth under reactive nitrogen stress and altered respiratory chain function .

  • Stress Response: Δrv3143 strains exhibit heightened sensitivity to valinomycin (a proton gradient disruptor) and upregulate nitrate respiration genes, suggesting NDH-1 compensates for oxidative stress .

  • Proton Translocation: NDH-1 couples electron transfer to proton pumping, critical for maintaining membrane potential .

Vaccine Development and Immunological Potential

nuoK is explored as a subunit vaccine candidate due to its conserved epitopes in Mycobacterium species. Recombinant BCG strains expressing heterologous antigens leverage M. bovis’ adjuvant properties, though nuoK-specific applications remain under investigation .

Research Gaps and Future Directions

  • Structural Elucidation: Full crystallographic data for nuoK is lacking; partial structures hinder mechanistic insights .

  • Therapeutic Targeting: While NDH-2 is prioritized for drug development, NDH-1 (including nuoK) may offer redundancy in metabolic pathways, necessitating dual inhibition strategies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
nuoK; BCG_3178; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Target Names
nuoK
Target Protein Sequence
MNPANYLYLSVLLFTIGASGVLLRRNAIVMFMCVELMLNAVNLAFVTFARMHGHLDAQMI AFFTMVVAACEVVVGLAIIMTIFRTRKSASVDDANLLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, the primary electron acceptor for the enzyme is believed to be menaquinone. The enzyme couples the redox reaction to proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy as a proton gradient.
Database Links

KEGG: mbb:BCG_3178

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mycobacterium bovis nuoK protein and what is its biological significance?

Mycobacterium bovis nuoK protein is a subunit of NADH-quinone oxidoreductase (also known as Complex I) in the mycobacterial electron transport chain. Specifically, nuoK (aa 1-99) from Mycobacterium bovis strain BCG/Pasteur 1173P2 is a membrane-embedded component of this respiratory complex . The biological significance of nuoK lies in its role within Complex I, which serves as an entry point for electrons from NADH into the mycobacterial electron transport chain, facilitating energy production through oxidative phosphorylation. Complex I in mycobacteria contributes to respiratory flexibility, which is particularly important under varying environmental conditions and nutrient availability .

How does Mycobacterium bovis nuoK compare structurally to equivalent proteins in other bacterial species?

The nuoK subunit in Mycobacterium bovis forms part of the membrane domain of respiratory Complex I. While specific structural data on isolated nuoK is limited, cryoEM studies of complete mycobacterial Complex I at 2.6 Å resolution reveal important structural features. Unlike some bacterial species that utilize ubiquinone, mycobacterial Complex I, including its nuoK component, has evolved to interact with menaquinone as the preferred lipid-soluble electron carrier . This adaptation reflects evolutionary differences in respiratory chains across bacterial species.

The membrane domain containing nuoK shows conservation of critical residues involved in proton translocation, though with specific adaptations related to menaquinone utilization compared to ubiquinone-utilizing species. These structural differences have significant implications for inhibitor binding and potential drug development targeting mycobacterial respiratory complexes.

What expression systems are commonly used for recombinant production of Mycobacterium bovis nuoK?

Recombinant Mycobacterium bovis nuoK protein can be produced using several expression systems, each with distinct advantages:

  • Escherichia coli expression system: Most commonly used due to its simplicity, rapid growth, and high protein yields. This system is particularly useful for producing the soluble domains of membrane proteins like nuoK .

  • Yeast expression systems: Offer eukaryotic post-translational modifications while maintaining relatively high yields and simple cultivation requirements .

  • Baculovirus expression systems: Provide superior folding of complex proteins and are particularly valuable for structural studies requiring highly purified, correctly folded protein.

  • Mammalian cell expression systems: Offer the most sophisticated post-translational modifications but at higher cost and lower yields .

The choice of expression system depends on research objectives. For functional studies requiring proper membrane insertion, yeast or insect cell systems may be preferable, while E. coli systems are often sufficient for antibody production or initial characterization studies.

What purification strategies yield the highest activity for recombinant Mycobacterium bovis nuoK protein?

Purification of recombinant Mycobacterium bovis nuoK protein presents challenges due to its membrane-embedded nature. Based on successful purification of mycobacterial Complex I, the following strategies yield optimal results:

  • Detergent selection: Mild detergents such as n-dodecyl β-D-maltoside (DDM) maintain protein activity while effectively solubilizing membrane proteins.

  • Affinity chromatography: Utilizing epitope tags (such as FLAG or His-tags) enables efficient initial purification. Evidence from mycobacterial studies shows that FLAG-tagged Complex I subunits can retain activity after purification .

  • Size exclusion chromatography: This technique helps separate correctly assembled complexes from aggregates or partial assemblies.

  • Lipid supplementation: Addition of specific lipids during purification, particularly acyl phosphatidylinositol dimannoside found in mycobacterial membranes, stabilizes the protein complex .

Optimization of growth conditions prior to purification significantly impacts yield and activity. For mycobacterial Complex I, cultivation under carbon-limited conditions markedly increases expression compared to standard high-carbohydrate media or hypoxic conditions . This approach yielded preparations with specific activities of approximately 5 μmol/min/mg with both decylubiquinone and menadione as electron acceptors.

How can researchers accurately measure the enzymatic activity of recombinant Mycobacterium bovis nuoK within Complex I?

Accurate measurement of enzymatic activity requires specialized approaches due to the integral membrane nature of nuoK and its function within Complex I. The following methodological approaches are recommended:

  • NADH:quinone oxidoreductase activity assay: This spectrophotometric method monitors NADH oxidation at 340 nm. The activity can be measured using different quinone analogs as electron acceptors:

    • Decylubiquinone (dQ): Demonstrates approximately 5 μmol/min/mg activity with purified mycobacterial Complex I .

    • Menadione (MD): Shows similar specific activity of approximately 5 μmol/min/mg .

  • Inhibitor sensitivity assays: Using rotenone, a competitive inhibitor that blocks the quinone binding site, provides valuable information about enzymatic mechanism. Research indicates that 50 μM rotenone decreases mycobacterial Complex I activity by approximately 50%, while 150 μM rotenone reduces NADH:decylubiquinone oxidoreductase activity by ~90% but NADH:menadione oxidoreductase activity by only ~50% . This differential inhibition profile helps characterize quinone binding site preferences.

  • Membrane potential measurements: Since Complex I activity contributes to proton translocation, measuring membrane potential using fluorescent probes provides functional data in reconstituted systems.

The absence of the deactive to active transition in mycobacterial Complex I, which is characterized by an initial delay in NADH oxidation, distinguishes it from vertebrate and fungal Complex I enzymes , requiring adjustment of experimental protocols.

What are the recommended conditions for storage and handling of purified recombinant Mycobacterium bovis nuoK to maintain stability?

Maintaining stability of purified recombinant Mycobacterium bovis nuoK requires careful attention to storage and handling conditions:

  • Temperature: Store at -80°C for long-term storage, with minimal freeze-thaw cycles to prevent denaturation.

  • Buffer composition:

    • pH maintenance between 7.0-7.5

    • Inclusion of glycerol (10-20%) as a cryoprotectant

    • Addition of mild detergent at concentrations above critical micelle concentration to maintain solubility

    • Presence of reducing agents such as dithiothreitol (DTT) or β-mercaptoethanol to prevent oxidation of cysteine residues

  • Lipid supplementation: Including natural mycobacterial lipids or synthetic phospholipids enhances stability, particularly acyl phosphatidylinositol dimannoside, which has been identified at the interface of subunits in the Complex I structure .

  • Avoidance of metal contaminants: Chelating agents like EDTA at low concentrations help prevent metal-catalyzed oxidation.

For experimental protocols requiring room temperature handling, stability can be extended by working with reconstituted proteoliposomes rather than detergent-solubilized protein.

What structural features of Mycobacterium bovis nuoK are critical for its function in menaquinone binding?

The structural features of Mycobacterium bovis nuoK that facilitate menaquinone binding and function include:

  • Membrane-embedded residues: nuoK contributes to the formation of the quinone binding pocket within the membrane domain of Complex I. High-resolution cryoEM studies at 2.6 Å have revealed that the mycobacterial Complex I has evolved specific adaptations for menaquinone interactions .

  • Hydrophobic channel: nuoK helps form a hydrophobic channel that allows menaquinone access to the electron transfer site near the N2 iron-sulfur cluster.

  • Conserved charged residues: Specific charged amino acids within nuoK contribute to proton translocation coupled to electron transfer.

  • Structural flexibility: The protein exhibits conformational changes during the catalytic cycle that are essential for coupling electron transport to proton translocation.

The preference for menaquinone over ubiquinone in mycobacterial respiratory chains represents an important adaptation to their environmental niche and metabolic requirements. This adaptation is reflected in the structural arrangement of nuoK and its neighboring subunits, particularly the differential sensitivity to inhibitors like rotenone when using menaquinone versus ubiquinone analogs .

How does the integration of nuoK into the complete respiratory Complex I affect its structural properties?

The integration of nuoK into the complete respiratory Complex I significantly alters its structural properties compared to the isolated subunit:

  • Tertiary structure stabilization: Interactions with adjacent subunits, particularly NuoL and NuoM, stabilize the tertiary structure of nuoK. At the interface between these subunits, acyl phosphatidylinositol dimannoside, an abundant mycobacterial lipid, has been identified in structural studies .

  • Transmembrane helix orientation: The transmembrane helices of nuoK adopt specific orientations within the complex that are crucial for proton translocation. These orientations are maintained through interactions with other membrane subunits.

  • Conformational dynamics: While individual nuoK may exhibit significant conformational flexibility, incorporation into Complex I constrains these movements to coordinated conformational changes that facilitate proton pumping.

  • Accessibility of functional residues: Integration into the complex positions key functional residues of nuoK in proximity to other catalytic residues and cofactors, particularly iron-sulfur clusters that form the electron transport chain within Complex I.

Structurally, mycobacterial Complex I exhibits both conserved features common to all Complex I enzymes and unique adaptations. For example, the presence of the two-component response regulator MSMEG_2064 as a subunit of the complex in mycobacteria indicates potential regulatory mechanisms not found in other bacterial species .

How can researchers effectively utilize Mycobacterium bovis nuoK in structure-based drug design targeting mycobacterial respiratory chains?

Effective utilization of Mycobacterium bovis nuoK in structure-based drug design requires a multi-faceted approach:

  • High-resolution structural data integration: The 2.6 Å resolution cryoEM structure of mycobacterial Complex I provides critical information about nuoK and its interactions within the respiratory complex . Researchers should focus on:

    • Identifying unique structural features absent in host (human) Complex I

    • Analyzing the menaquinone binding site, which differs from the ubiquinone binding site in mammalian Complex I

    • Mapping potential allosteric sites that could affect nuoK function

  • Differential inhibition analysis: The differential sensitivity to inhibitors observed between NADH:decylubiquinone and NADH:menadione oxidoreductase activities (90% vs. 50% inhibition with 150 μM rotenone, respectively) provides valuable insights for inhibitor design. This suggests multiple binding modes or access pathways that could be exploited for selective inhibition.

  • Molecular dynamics simulations: Computational methods should be employed to study:

    • Conformational changes during catalytic cycles

    • Water and proton pathways through the membrane domain

    • Binding energetics of potential inhibitors

  • Fragment-based screening approaches: Using a library of small molecular fragments to identify initial binding sites within nuoK or at interfaces with other subunits offers an efficient starting point for drug development.

The unique adaptations of mycobacterial Complex I, including its role in respiratory flexibility under different growth conditions , provide promising targets for novel antimycobacterial drugs that could complement existing tuberculosis treatments.

What is the role of Mycobacterium bovis nuoK in antibiotic resistance development?

The role of Mycobacterium bovis nuoK in antibiotic resistance development is multi-faceted:

  • Metabolic adaptation: Complex I activity, including nuoK function, contributes to metabolic flexibility in mycobacteria. Under carbon-limited conditions, Complex I expression increases , potentially allowing the bacterium to adapt to stressful conditions including antibiotic exposure.

  • Energy production under stress: When exposed to antibiotics that disrupt energy metabolism, functional nuoK within Complex I may provide alternative electron transport pathways that maintain sufficient proton-motive force for bacterial survival.

  • Redox balance maintenance: By facilitating electron transfer from NADH to menaquinone, nuoK helps maintain cellular redox balance, which can protect against oxidative stress induced by certain antibiotics.

  • Persister cell formation: Changes in respiratory chain activity, including Complex I function, have been implicated in the formation of persister cells—metabolically quiescent bacteria that exhibit phenotypic drug tolerance without genetic resistance mechanisms.

Interestingly, while Complex I containing nuoK is expressed under certain growth conditions, deletion of essential Complex I components (such as nuoF) does not result in noticeable growth defects in liquid culture . This suggests redundancy in the mycobacterial electron transport chain, which may contribute to the organism's robustness in the face of antibiotic challenge.

How does the expression and function of Mycobacterium bovis nuoK vary under different growth conditions and how does this impact experimental design?

The expression and function of Mycobacterium bovis nuoK exhibit significant variation under different growth conditions, which has profound implications for experimental design:

Growth ConditionNuoC (Complex I) ExpressionType II NADH Dehydrogenase (Ndh) ExpressionImpact on Experimental Design
Carbon-limited (little/no carbohydrate)HighRelatively stableOptimal for Complex I isolation
Standard (0.2% or 11 mM glucose)ReducedRelatively stableSuboptimal for Complex I studies
Hypoxic conditionsUndetectableRelatively stableUnsuitable for Complex I research

These expression patterns demonstrate a significant regulatory response to environmental conditions that must be considered when designing experiments:

  • Growth media selection: For studies focused on nuoK function within Complex I, carbon-limited growth conditions are essential to ensure adequate expression levels . This represents a departure from standard mycobacterial culture protocols that typically use higher carbohydrate concentrations.

  • Genetic manipulation strategies: The absence of growth defects in nuoF deletion strains (where the FMN-binding subunit essential for Complex I activity is removed) suggests functional redundancy in the electron transport chain . Researchers must therefore consider:

    • Double or triple knockout strategies to eliminate redundant pathways

    • Conditional expression systems to study essential combinations

    • Complementation experiments to verify phenotype attribution

  • Physiological relevance considerations: The increased expression of Complex I under carbon limitation suggests its importance in natural environments where nutrients may be scarce . Experimental designs should include conditions that mimic in vivo environments rather than standard laboratory media.

  • Activity assay modifications: The choice of electron acceptor significantly impacts measured activities and inhibitor sensitivities. Experiments should include both decylubiquinone and menadione to comprehensively characterize Complex I function .

These considerations are essential for generating reproducible and physiologically relevant data on Mycobacterium bovis nuoK function within Complex I.

How do genetic variations in Mycobacterium bovis nuoK correlate with transmission patterns in bovine tuberculosis?

Genetic variations in Mycobacterium bovis nuoK and other respiratory chain components provide valuable insights into transmission patterns in bovine tuberculosis:

  • Phylogenetic analysis: Whole genome sequencing and phylogenetic tree construction of M. bovis isolates reveal clades that include both cattle- and badger-derived sequences, with genetic differences ranging from 0 to 150 Single Nucleotide Variants (SNVs) (median = 20) . These variations, including those in respiratory chain components like nuoK, serve as molecular markers for tracking transmission chains.

  • Host adaptation signatures: Specific variants in nuoK and other respiratory complex genes may reflect adaptation to different host environments. The respiratory flexibility conferred by Complex I appears particularly important in carbon-limited conditions , which may represent an adaptation to specific host environments.

  • Transmission directionality: Bayesian phylogenetic analyses of M. bovis genomes suggest that transmission occurs more frequently from badgers to cattle than vice versa (approximately 10.4 times more likely in the most probable model) . Genetic variations in metabolic genes, including respiratory chain components, contribute to these phylogenetic signals.

  • Within-species vs. between-species transmission: Genetic data indicates that within-species transmission rates exceed between-species transmission rates for both cattle and badgers . This suggests that while zoonotic transmission occurs, maintenance of strain variants within a single host species is more common.

For researchers studying nuoK, these findings highlight the importance of considering host origin when analyzing protein function and suggest that subtle variations in respiratory chain components may contribute to host adaptation and transmission success.

What insights can comparative analysis of Mycobacterium bovis nuoK and equivalent proteins in Mycobacterium tuberculosis provide for tuberculosis research?

Comparative analysis of Mycobacterium bovis nuoK and its Mycobacterium tuberculosis counterpart offers valuable insights for tuberculosis research:

  • Conservation and divergence patterns: Despite the close phylogenetic relationship between M. bovis and M. tuberculosis, subtle sequence differences in nuoK may reflect adaptation to different primary hosts (cattle versus humans). These differences can highlight residues under selection pressure that may be functionally significant.

  • Differential expression regulation: Both species show altered Complex I expression under different growth conditions , but species-specific regulatory mechanisms may exist. Understanding these differences could reveal:

    • Host-specific adaptation mechanisms

    • Potential vulnerabilities for targeted drug development

    • Metabolic requirements in different infection contexts

  • Drug sensitivity profiles: Comparing inhibitor effects on nuoK function between species can identify species-specific vulnerabilities. The differential sensitivity to rotenone observed in mycobacterial Complex I when using different electron acceptors suggests complex binding site interactions that may vary between species.

  • Contribution to virulence: While M. tuberculosis is primarily a human pathogen causing tuberculosis, M. bovis has a broader host range but typically causes a similar disease . Differences in respiratory chain components like nuoK may contribute to this host range variation and disease progression patterns.

The documented respiratory flexibility of mycobacteria, with Complex I being dispensable under certain conditions but highly expressed in others , may represent a common adaptation strategy across pathogenic mycobacterial species that contributes to their success as pathogens.

How can structural information about Mycobacterium bovis nuoK inform broader studies of bacterial respiratory chain evolution?

Structural information about Mycobacterium bovis nuoK provides critical insights into bacterial respiratory chain evolution:

  • Menaquinone adaptation signatures: The structural features of mycobacterial Complex I, including nuoK, that facilitate menaquinone binding instead of ubiquinone represent an important evolutionary adaptation . Comparative analysis of these features across bacterial phyla can trace the evolution of quinone specificity and its relationship to ecological niches.

  • Novel subunit incorporation: The identification of a two-component response regulator (MSMEG_2064) as a subunit of mycobacterial Complex I represents an unusual fusion of signaling and metabolic functions. This finding suggests:

    • Potential regulatory mechanisms linking environmental sensing to respiratory function

    • Evolutionary innovations specific to certain bacterial lineages

    • New paradigms for understanding protein complex assembly and regulation

  • Iron-sulfur cluster arrangement: The arrangement of iron-sulfur clusters in Complex I, which accepts electrons from NADH before sequential transfer through eight iron-sulfur clusters (N1a, N1b, N2, N3, N4, N5, N6a, and N6b) to the membrane-embedded quinone , represents a conserved electron transfer mechanism with specific adaptations in different bacterial lineages.

  • Homology relationships: The structural similarity between the NuoG subunit of Complex I and formate dehydrogenases, supported by the presence of a purine nucleoside triphosphate molecule adjacent to iron-sulfur cluster N7 , reveals deep evolutionary relationships between seemingly distinct enzyme systems.

These structural insights demonstrate how respiratory chains have evolved through gene duplication, functional divergence, and modular assembly of protein domains. The ability to switch between different respiratory modes depending on environmental conditions represents a fundamental bacterial adaptation strategy that has been refined in different lineages through structural modifications to proteins like nuoK.

What are the most promising approaches for utilizing Mycobacterium bovis nuoK as a potential vaccine development target?

Several promising approaches exist for utilizing Mycobacterium bovis nuoK as a potential vaccine development target:

  • Recombinant subunit vaccines: Purified recombinant nuoK protein can be used as an antigen component in subunit vaccines. The availability of expression systems for producing recombinant Mycobacterium bovis nuoK protein facilitates this approach. Key considerations include:

    • Appropriate adjuvant selection to enhance immunogenicity

    • Combination with other mycobacterial antigens for broader protection

    • Delivery systems that present the protein in its native conformation

  • Epitope mapping and synthetic peptide vaccines: Bioinformatic analysis of nuoK can identify potential B-cell and T-cell epitopes that could be synthesized as peptides for vaccination. Advantages include:

    • Focused immune response against immunodominant epitopes

    • Elimination of potentially harmful regions of the protein

    • Simplified production and quality control

  • Attenuated strains with modified nuoK: Engineering M. bovis strains with modified nuoK that maintain immunogenicity while reducing virulence could provide live attenuated vaccine candidates. The understanding that Complex I is not essential for growth under standard laboratory conditions suggests that modifications to nuoK might be tolerated while maintaining strain viability.

  • DNA vaccines encoding nuoK: Plasmid DNA encoding nuoK could be used for vaccination, potentially eliciting both humoral and cell-mediated immunity.

Importantly, all vaccine applications must acknowledge the statement that "These vaccine ingredients CANNOT be used directly on humans or animals" without proper development, testing, and regulatory approval. Any vaccine development would require extensive safety and efficacy testing beyond the current research use of these proteins.

What technological advances are needed to better characterize the dynamic interactions of nuoK within the complete respiratory chain under physiological conditions?

Several technological advances are needed to better characterize the dynamic interactions of nuoK within the complete respiratory chain under physiological conditions:

These technological advances would help resolve currently unanswered questions about how mycobacteria regulate electron flow through different branches of their respiratory chain and how these processes contribute to pathogenesis and antibiotic resistance.

How might genetic engineering of Mycobacterium bovis nuoK contribute to development of attenuated strains for research and potential vaccine applications?

Genetic engineering of Mycobacterium bovis nuoK offers several strategic approaches for developing attenuated strains for research and potential vaccine applications:

  • Site-directed mutagenesis of catalytic residues: Introducing specific mutations in nuoK that reduce but don't eliminate Complex I activity could create strains with:

    • Reduced virulence due to compromised energy metabolism

    • Maintained immunogenicity for vaccine applications

    • Defined genetic modifications for regulatory purposes

  • Conditional expression systems: Creating strains where nuoK expression is under control of inducible promoters would allow:

    • Precise regulation of respiratory chain function for research

    • Development of self-limiting vaccine strains that attenuate after initial replication

    • Investigation of Complex I essentiality under different in vivo conditions

  • Reporter fusions: Creating nuoK-reporter protein fusions would facilitate:

    • Real-time monitoring of expression in different tissues

    • Screening for conditions that modulate Complex I activity

    • Tracking of bacterial persistence in host tissues

  • Domain swapping with non-pathogenic mycobacteria: Replacing regions of nuoK with equivalents from non-pathogenic mycobacterial species could generate strains with altered host adaptation while maintaining antigenic properties.

Researchers must verify that any attenuated strains remain stable in vivo and don't revert to virulence, especially considering the complex transmission dynamics of M. bovis between animal hosts .

How does current understanding of Mycobacterium bovis nuoK integrate with broader research on mycobacterial bioenergetics and pathogenesis?

The current understanding of Mycobacterium bovis nuoK integrates with broader research on mycobacterial bioenergetics and pathogenesis in several key ways:

  • Respiratory flexibility model: The finding that Complex I containing nuoK is highly expressed under carbon-limited conditions but dispensable under standard laboratory growth conditions supports a model where mycobacteria adjust their respiratory chain composition in response to environmental conditions. This flexibility likely contributes to survival in diverse host microenvironments during infection.

  • Host-pathogen interaction framework: The variability in Complex I expression under different conditions aligns with emerging models of how mycobacteria adapt to changing host environments during infection progression, from initial aerobic conditions to microaerophilic granulomas.

  • Drug resistance mechanisms: Understanding nuoK function within Complex I contributes to models of how mycobacteria develop resistance to antibiotics targeting energy metabolism, with implications for developing new therapeutic strategies that account for respiratory chain adaptability.

  • Transmission dynamics: The genomic analysis revealing bidirectional but asymmetric transmission of M. bovis between cattle and wildlife reservoirs provides context for understanding how metabolic adaptations, including respiratory chain modifications, might facilitate host switching and persistence in different animal populations.

This integrated perspective suggests that while nuoK and Complex I may not be essential under all conditions, they form a critical component of the adaptive capacity that makes mycobacterial infections persistent and difficult to eradicate. Future research should address how these bioenergetic adaptations intersect with immune evasion strategies and antibiotic resistance mechanisms.

What consensus has emerged regarding the relative importance of Complex I versus alternative NADH dehydrogenases in mycobacterial metabolism?

A nuanced consensus has emerged regarding the relative importance of Complex I (containing nuoK) versus alternative NADH dehydrogenases in mycobacterial metabolism:

This consensus emphasizes that mycobacterial respiratory chains should be viewed as dynamically regulated systems rather than fixed pathways, with implications for how we understand mycobacterial adaptation to host environments and design targeted interventions.

What are the critical unanswered questions about Mycobacterium bovis nuoK that would most significantly advance tuberculosis research if resolved?

Several critical unanswered questions about Mycobacterium bovis nuoK would significantly advance tuberculosis research if resolved:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.