Recombinant Mycobacterium bovis Peptidoglycan-binding protein ArfA (arfA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
arfA; ompA; BCG_0951; Peptidoglycan-binding protein ArfA; Outer membrane protein A; OmpATb; Outer membrane protein ArfA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-326
Protein Length
full length protein
Species
Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Target Names
arfA
Target Protein Sequence
MASKAGLGQTPATTDARRTQKFYRGSPGRPWLIGAVVIPLLIAAIGYGAFERPQSVTGPT GVLPTLTPTSTRGASALSLSLLSISRSGNTVTLIGDFPDEAAKAALMTALNGLLAPGVNV IDQIHVDPVVRSLDFSSAEPVFTASVPIPDFGLKVERDTVTLTGTAPSSEHKDAVKRAAT STWPDMKIVNNIEVTGQAPPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEIL NRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGL GSVNPIASNATPEGRAKNRRVEIVVN
Uniprot No.

Target Background

Function
ArfA, a recombinant Mycobacterium bovis peptidoglycan-binding protein, may contribute to ammonia secretion, neutralizing the medium at pH 5.5, though not directly involved in ammonia transport. It binds peptidoglycan and its expression is dependent on arfB and arfC.
Database Links

KEGG: mbb:BCG_0951

Protein Families
OmpA family, ArfA(Rv0899) subfamily
Subcellular Location
Cell outer membrane.

Q&A

What is the domain organization of M. bovis ArfA protein?

ArfA (homologous to Rv0899 in M. tuberculosis) consists of three independently structured domains. The N-terminus (M domain; residues 1–80) contains a membrane-anchoring sequence of 20 hydrophobic amino acids (residues 28–50) that is required for membrane translocation but is not cleaved. The central region (B domain; residues 81–195) contains two consecutive repeats of the BON (Bacterial OsmY and Nodulation) domain, a conserved sequence found in some bacterial osmotic shock protection proteins. The C-terminal region (C domain; residues 196–326) shares significant sequence homology with the OmpA-like superfamily of peptidoglycan-binding proteins .

What structural features of the ArfA C-domain enable peptidoglycan binding?

The C-domain of ArfA adopts the characteristic βαβαβαβ core structure of the OmpA-like family. The peptidoglycan binding site is formed by a surface cavity created by residues in the β1-α2 and β2-α3 loops, the N-terminus of helix α3, and the C-terminus of helix α4. Five highly conserved residues, including two key arginine residues, establish specificity for diaminopimelate (DAP)-type peptidoglycan rather than lysine-type peptidoglycan. This binding site architecture enables ArfA to recognize specific components of mycobacterial cell wall peptidoglycan .

How does pH affect ArfA C-domain conformation and function?

The C-domain of ArfA exhibits pH-dependent conformational dynamics with significant heterogeneity at neutral pH and a more ordered structure at acidic pH. This pH-dependent structural transition appears in the β1-α2 loop region. When researchers mutated L232 to glycine in this loop, they observed effects on other structured regions of the protein. This conformational plasticity may relate to ArfA's function in acid stress response, providing structural support to the bacterial cell envelope under acidic conditions. Interestingly, both the wild-type and D236A mutant forms of ArfA-C bind intact peptidoglycan, indicating that the acid-dependent structural heterogeneity of the β1-α2 loop does not affect peptidoglycan binding capability .

What is the physiological role of ArfA in M. bovis survival?

ArfA is encoded by an operon (which includes arfA, arfB, and arfC) that is required for bacterial growth in acidic environments. The operon facilitates fast ammonia secretion and rapid pH neutralization, critical for mycobacterial survival under acidic stress. This function is particularly important for pathogenic mycobacteria like M. bovis, which must survive in acidified phagosomes within host cells. The peptidoglycan-binding capability of ArfA suggests that its acid stress protection function is linked to interactions with the mycobacterial cell wall, potentially conferring structural strength under stress conditions .

How does ArfA contribute to the bacterial cell wall integrity during acid stress?

ArfA likely provides structural support to the cell envelope during acid stress through its specific interaction with peptidoglycan. By binding to the peptidoglycan layer, ArfA may stabilize the cell wall architecture when bacteria experience acidic conditions. The pH-dependent conformational changes observed in the C-domain could represent a molecular switch that enhances peptidoglycan interaction under acidic conditions. This structural reinforcement would help maintain cell envelope integrity during the significant chemical stress that acidic environments impose on bacterial cells .

What is the significance of ArfA as the first identified peptidoglycan-binding protein in pathogenic mycobacteria?

The identification of ArfA as the first known peptidoglycan-binding protein in M. tuberculosis (and by extension, in M. bovis) represents a significant advancement in understanding mycobacterial cell wall biology. This discovery establishes a direct molecular link between acid stress response mechanisms and cell wall maintenance. Since the cell envelope plays a crucial role in bacterial adaptation and survival, ArfA's dual function in acid resistance and cell wall interaction suggests integrated stress response pathways in pathogenic mycobacteria. This finding opens new avenues for research into cell wall-associated stress responses that may be exploited for therapeutic intervention .

What methods are most effective for recombinant expression and purification of ArfA?

For effective recombinant expression of ArfA, researchers should consider:

  • Expression system selection: E. coli BL21(DE3) strain with pET expression vectors has been successfully used for ArfA domains.

  • Domain-specific expression: Due to ArfA's multi-domain nature, expressing individual domains (especially the B and C domains) yields better results than full-length protein expression.

  • Purification protocol:

    • Initial capture using affinity chromatography (His-tag purification)

    • Intermediate purification with ion exchange chromatography

    • Final polishing with size exclusion chromatography

  • Buffer optimization: For the C-domain, buffers at both pH 7.0 and pH 4.0 should be prepared to study pH-dependent conformational changes.

For membrane-associated full-length ArfA, consider detergent-based extraction methods using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) .

How can researchers effectively study the peptidoglycan-binding properties of ArfA?

To study ArfA peptidoglycan binding, several complementary approaches can be employed:

  • Peptidoglycan pull-down assays: Incubate soluble ArfA with insoluble polymeric peptidoglycan isolated from M. tuberculosis or M. bovis, followed by centrifugation to separate bound (pellet) and unbound (supernatant) fractions. Analyze by SDS-PAGE.

  • NMR spectroscopy with soluble peptidoglycan fragments: Use 15N-labeled ArfA and monitor chemical shift perturbations upon addition of soluble peptidoglycan intermediates like UMDP (Park's nucleotide).

  • Mutagenesis studies: Generate site-directed mutants of key residues in the putative binding site and assess their effect on peptidoglycan binding.

  • Specificity analysis: Test binding with different peptidoglycan components (MurNAc, MurNGlyc, dipeptides like GMAG) to determine specific recognition requirements.

  • Isothermal titration calorimetry (ITC): Quantify binding affinity and thermodynamic parameters of ArfA-peptidoglycan interactions .

What advanced structural biology techniques would best elucidate ArfA's conformational dynamics?

To investigate the conformational dynamics of ArfA, particularly its pH-dependent structural changes, the following advanced techniques are recommended:

How does ArfA from M. bovis compare to its homologs in other mycobacterial species?

ArfA (Rv0899 homolog) shows distinctive distribution patterns across mycobacterial species:

SpeciesArfA PresenceDisease AssociationSequence Identity to M. bovis ArfA
M. tuberculosisPresentTuberculosis>99%
M. bovisPresentBovine tuberculosis100% (reference)
M. marinumPresentFish tuberculosis, granulomatous lesions in humans~85%
M. ulceransPresentBuruli ulcer~84%
M. kansasiiPresentPulmonary disease resembling tuberculosis~83%
M. smegmatisAbsentNon-pathogenicN/A
M. aviumAbsentOpportunistic infectionsN/A

The arf operon (arfA, arfB, arfC) is found exclusively in pathogenic mycobacteria associated with tuberculosis and other diseases. This distribution pattern suggests ArfA may have a role in pathogenicity and makes it an attractive candidate for the development of anti-tuberculosis therapeutics .

What methodological approaches should be used when comparing peptidoglycan recognition by ArfA across different mycobacterial species?

To effectively compare peptidoglycan recognition by ArfA across different mycobacterial species, researchers should employ a systematic approach:

  • Sequence alignment and phylogenetic analysis: Compare ArfA sequences from different species to identify conserved residues in the peptidoglycan-binding domain.

  • Homology modeling: For species where ArfA structure is not experimentally determined, create homology models based on the known M. tuberculosis ArfA structure.

  • Peptidoglycan isolation from multiple species: Extract and purify peptidoglycan from various mycobacterial species using standardized protocols to ensure comparable samples.

  • Binding specificity assays: Conduct cross-binding experiments where ArfA from one species is tested against peptidoglycan from multiple species to assess recognition specificity.

  • Structural characterization of species-specific differences:

    • Focus on the five key conserved residues identified in the peptidoglycan binding site

    • Pay particular attention to the two critical arginine residues that establish specificity for DAP-type peptidoglycan

  • Functional complementation studies: Express ArfA from different species in an arfA knockout strain to assess functional conservation .

How does ArfA contribute to M. bovis survival during host immune response?

ArfA likely contributes to M. bovis survival during host immune responses through multiple mechanisms:

  • Acid stress resistance: ArfA's role in ammonia secretion and pH neutralization helps M. bovis survive within acidified phagosomes of macrophages and dendritic cells.

  • Cell wall maintenance: By binding to peptidoglycan, ArfA may contribute to cell wall integrity when bacteria face host-generated stresses, including acidic phagosomal environments.

  • Immune evasion: The structural integrity of the cell wall is crucial for mycobacterial persistence and immune evasion. ArfA's cell wall maintenance function may contribute to reducing exposure of pathogen-associated molecular patterns (PAMPs) to host pattern recognition receptors.

  • Modulation of innate responses: Maintaining proper cell wall structure affects how M. bovis interacts with antigen-presenting cells (APCs), potentially influencing downstream adaptive immune responses .

How might ArfA-mediated changes in cell wall structure influence innate immune recognition of M. bovis?

ArfA-mediated changes in cell wall structure could significantly influence innate immune recognition through several mechanisms:

  • Alteration of PAMP exposure: Changes in peptidoglycan architecture could affect the exposure of cell wall components recognized by pattern recognition receptors (PRRs) like NOD1, NOD2, and TLRs.

  • Impact on antigen processing: ArfA's role in maintaining cell wall integrity might affect how cell wall antigens are processed and presented by antigen-presenting cells (APCs).

  • Modulation of cytokine responses: Different M. bovis strains induce differential macrophage responses in vitro. ArfA-mediated cell wall modifications could contribute to strain-specific immune stimulation patterns.

  • Influence on DC-NK cell interactions: Upon M. bovis infection, dendritic cells secrete chemokines to recruit natural killer (NK) cells. ArfA's contribution to bacterial survival could indirectly affect this DC-mediated recruitment and subsequent NK cell activation .

What advanced experimental systems would best model ArfA function during host infection?

To effectively model ArfA function during host infection, researchers should consider these advanced experimental systems:

  • ArfA knockout and complementation studies:

    • Generate clean arfA deletion mutants in M. bovis

    • Complement with wild-type arfA or variants with mutations in key peptidoglycan-binding residues

    • Assess survival in acidified media and within macrophages

  • Ex vivo infection models:

    • Primary bovine macrophages and dendritic cells

    • Tissue explant cultures from bovine lungs

    • Human cell models for zoonotic transmission studies

  • 3D tissue culture systems:

    • Lung-on-chip microfluidic devices

    • Organoid cultures to model tissue-specific responses

  • In vivo imaging technologies:

    • Fluorescently tagged ArfA to track localization during infection

    • Dual reporter systems to monitor arfA expression and bacterial stress responses simultaneously

  • Single-cell analyses:

    • Transcriptomics to assess host cell responses to wild-type versus arfA mutant bacteria

    • Spatial proteomics to visualize ArfA localization during different stages of infection .

How can ArfA be utilized as a potential target for anti-tuberculosis therapeutics?

ArfA represents a promising target for anti-tuberculosis therapeutics for several reasons:

  • Essentiality for acid stress survival: The arf operon is required for bacterial growth in acidic environments, making it critical for survival within host macrophages.

  • Restricted distribution: The arf operon is found exclusively in pathogenic mycobacteria, reducing the risk of broad antibacterial effects.

  • Structural targetability: The well-defined peptidoglycan-binding pocket of ArfA presents opportunities for structure-based drug design.

  • Multiple targeting approaches:

    • Small-molecule inhibitors of peptidoglycan binding

    • Peptidomimetics that compete for the binding site

    • Allosteric modulators affecting pH-dependent conformational changes

    • Compounds that disrupt the function of the entire Arf operon

  • Potential for combination therapy: ArfA inhibitors could be combined with other anti-TB drugs to enhance efficacy, particularly against persistent bacteria in acidic microenvironments .

What methodological considerations are important when developing assays to screen for ArfA inhibitors?

When developing assays to screen for ArfA inhibitors, researchers should consider these methodological approaches:

  • Biochemical assays:

    • Fluorescence polarization assays using labeled peptidoglycan fragments

    • AlphaScreen or FRET-based assays to detect disruption of ArfA-peptidoglycan binding

    • NMR-based fragment screening against the peptidoglycan binding site

  • Cell-based assays:

    • Reporter strains expressing luciferase under pH-responsive promoters

    • Growth inhibition assays in acidified media

    • Intracellular survival assays in macrophages

  • Assay considerations:

    • Test compounds at both neutral and acidic pH to account for conformational dynamics

    • Include controls to distinguish between direct ArfA inhibition and general effects on membrane integrity

    • Counter-screen against other peptidoglycan-binding proteins to assess specificity

  • Validation approaches:

    • Thermal shift assays to confirm direct binding to ArfA

    • Surface plasmon resonance to quantify binding kinetics

    • Crystallography or NMR to validate binding modes

    • Testing against arfA mutant strains to confirm mechanism of action .

How might genetic variability in ArfA across clinical M. bovis isolates impact vaccine development strategies?

Genetic variability in ArfA across clinical M. bovis isolates could significantly impact vaccine development strategies in several ways:

  • Epitope conservation analysis:

    • Researchers should conduct comprehensive sequence analysis of arfA genes from diverse clinical isolates

    • Identify conserved versus variable regions to select stable antigenic determinants

  • Strain-specific immune responses:

    • Different M. bovis strains or genotypes induce differential macrophage responses in vitro

    • ArfA variability might contribute to strain-specific immune evasion mechanisms

    • Vaccine constructs should account for immunologically significant variants

  • Rational vaccine design approach:

    • Consider incorporating multiple ArfA variants or consensus sequences in vaccine formulations

    • Focus on conserved peptidoglycan-binding residues as potential B-cell or T-cell epitopes

    • Evaluate cross-protection against diverse strains in animal models

  • Impact on vaccine delivery mechanisms:

    • If using live attenuated vaccines, consider how ArfA variants affect intracellular survival

    • For subunit vaccines, evaluate how sequence variations impact protein folding and epitope presentation

  • Monitoring post-vaccination:

    • Develop assays to monitor immune responses to ArfA epitopes

    • Track potential vaccine escape through ArfA mutations in circulating strains .

What are the optimal conditions for storing purified recombinant ArfA to maintain its structural integrity?

To maintain the structural integrity of purified recombinant ArfA, researchers should consider these storage conditions based on domain-specific requirements:

  • Full-length ArfA and M-domain:

    • Store in detergent-containing buffers (0.05-0.1% DDM or OG)

    • Buffer composition: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM EDTA, 5% glycerol

    • Flash-freeze in liquid nitrogen and store at -80°C

    • Avoid repeated freeze-thaw cycles

  • B-domain and C-domain:

    • Store in detergent-free buffers

    • For C-domain specifically, prepare aliquots at both pH 7.0 and pH 4.0 to preserve pH-dependent conformational states

    • Buffer composition: 20 mM sodium phosphate (pH 7.0) or 20 mM sodium acetate (pH 4.0), 100 mM NaCl

    • Add 5-10% glycerol as cryoprotectant

    • Store at -80°C for long-term or at 4°C for up to one week

  • Quality control before use:

    • Verify protein integrity by SDS-PAGE

    • Confirm proper folding by circular dichroism

    • For C-domain, use 1H-15N HSQC NMR to verify structural integrity at different pH values .

How can researchers effectively distinguish between different conformational states of ArfA in structural studies?

To effectively distinguish between different conformational states of ArfA, particularly the pH-dependent states of the C-domain, researchers should employ these complementary techniques:

  • Solution NMR spectroscopy:

    • Record 1H-15N HSQC spectra at various pH values (pH 4.0 to pH 7.0)

    • Analyze chemical shift perturbations to identify residues involved in conformational changes

    • Perform relaxation experiments (R1, R2, heteronuclear NOE) to characterize dynamic regions

    • Use CPMG relaxation dispersion to detect conformational exchange rates

  • Protein engineering approaches:

    • Design strategic mutations (such as L232G in the β1-α2 loop) to stabilize specific conformational states

    • Incorporate fluorescent labels at key positions to monitor conformational changes by FRET

    • Introduce disulfide bridges to trap specific conformations

  • Cryo-EM analysis:

    • Implement image classification algorithms to sort particles by conformational state

    • Perform pH-dependent sample preparation to capture different states

  • Computational methods:

    • Use molecular dynamics simulations to model conformational transitions

    • Implement enhanced sampling techniques (metadynamics, replica exchange) to characterize energy landscapes

    • Predict NMR observables from simulations for validation against experimental data .

What unresolved questions about ArfA present the most promising opportunities for high-impact research?

Several unresolved questions about ArfA present significant opportunities for high-impact research:

  • Molecular mechanism of acid resistance:

    • How does ArfA's peptidoglycan binding contribute mechanistically to acid stress protection?

    • What is the precise molecular pathway connecting ArfA to ammonia secretion?

    • How do the three Arf proteins (ArfA, ArfB, ArfC) coordinate functionally?

  • Structural biology frontiers:

    • What is the structure of full-length ArfA in a membrane environment?

    • How does ArfA interact with other cell wall components beyond peptidoglycan?

    • What is the atomic-level mechanism of pH-dependent conformational switching?

  • Host-pathogen interaction dynamics:

    • Does ArfA play a role in modulating host immune recognition?

    • How does ArfA contribute to bacterial persistence in granulomas?

    • Is ArfA involved in mycobacterial dormancy or resuscitation?

  • Therapeutic potential:

    • Can ArfA inhibitors synergize with existing TB drugs?

    • Would targeting ArfA reduce bacterial persistence without selecting for resistance?

    • Could ArfA be exploited as a novel vaccine antigen?

How might new technologies in structural biology advance our understanding of ArfA dynamics and interactions?

Emerging technologies in structural biology offer transformative potential for understanding ArfA:

  • Cryo-electron tomography:

    • Visualize ArfA in its native cellular context within the complex mycobacterial cell envelope

    • Map the spatial organization of ArfA relative to other cell wall components

    • Observe structural changes under different environmental conditions

  • Integrative structural biology approaches:

    • Combine NMR, X-ray crystallography, cryo-EM, and computational modeling

    • Generate comprehensive models of full-length ArfA in membrane environments

    • Characterize the structure of the entire Arf complex (ArfA-ArfB-ArfC)

  • Single-particle cryo-EM with time-resolved methods:

    • Capture ArfA in different functional states during pH transitions

    • Visualize conformational intermediates during peptidoglycan binding

  • Native mass spectrometry:

    • Determine stoichiometry and composition of ArfA-containing complexes

    • Characterize interaction networks in the mycobacterial cell envelope

  • In-cell structural biology:

    • Implement in-cell NMR to study ArfA dynamics in living mycobacteria

    • Use genetic code expansion to incorporate spectroscopic probes for in vivo studies .

What interdisciplinary approaches might yield new insights into ArfA's role in mycobacterial pathogenesis?

Interdisciplinary approaches that could yield transformative insights into ArfA's role in pathogenesis include:

  • Systems biology integration:

    • Multi-omics analyses (transcriptomics, proteomics, metabolomics) of wild-type vs. arfA mutants

    • Network modeling to position ArfA in stress response pathways

    • Machine learning approaches to identify patterns in ArfA-dependent phenotypes

  • Host-pathogen interface studies:

    • Single-cell RNA-seq of infected host cells to characterize ArfA-dependent immune signatures

    • Spatial transcriptomics to map ArfA activity within granulomas

    • Dual RNA-seq to simultaneously profile bacterial and host responses

  • Synthetic biology approaches:

    • Engineer synthetic ArfA variants with modified peptidoglycan binding properties

    • Create biosensors that report on ArfA activity or localization

    • Develop optogenetic tools to control ArfA function with light

  • Translational research connections:

    • Integrate ArfA research with clinical studies on drug-resistant tuberculosis

    • Explore correlations between ArfA sequence variants and disease outcomes

    • Develop point-of-care diagnostics based on ArfA-peptidoglycan interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.