Recombinant Mycobacterium bovis Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

ParameterDetails
Gene NamehtpX
Protein NameProtease HtpX homolog
Uniprot IDC1AKP3 (Mycobacterium bovis BCG strain)
EC Number3.4.24.- (zinc metalloprotease family)
Molecular Weight~30.7 kDa
Amino Acid SequenceMTWHPHANRLKTFLLLVGMSALIVAVGALFGRTALMLAALFAVGMNVYVYFNSDKLALRA... (1-286 aa)
Metal DependencyZinc (inferred from homologs in E. coli and M. tuberculosis)

Production and Purification

ParameterDetails
Expression HostE. coli (primary); yeast, baculovirus, or mammalian cells (alternative)
TagN-terminal His-tag (commonly used)
Purity>85% (SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol, pH 8.0
Storage Conditions-20°C/-80°C; avoid repeated freeze-thaw cycles

Biochemical Roles

  • Protease Activity: Belongs to the M48 family of zinc metalloproteases, implicated in protein quality control and membrane protein turnover .

  • Stress Response: Homologs in M. tuberculosis are regulated by transcription factors like Rv1152, which represses htpX to modulate vancomycin susceptibility .

  • Proteostasis: Interacts with chaperone systems (e.g., DnaK/DnaJ) to manage protein folding under stress, as observed in M. tuberculosis .

Research Applications

ApplicationDetails
Antibiotic SusceptibilityOverexpression of regulators like Rv1152 in M. tuberculosis reduces vancomycin sensitivity by repressing htpX .
Protease Activity AssaysIn vivo assays using engineered substrates enable detection of HtpX activity in membrane proteins .
Vaccine DevelopmentRecombinant HtpX is used to study immunogenicity and pathogenicity in mycobacterial models .

Table 2: Functional and Regulatory Insights

AspectDetails
Catalytic MechanismZinc-dependent cleavage of peptide bonds .
Regulatory ControlRepressed by Rv1152 (GntR-family transcription factor) in M. tuberculosis .
Substrate SpecificityTargets membrane-associated proteins (inferred from E. coli HtpX) .

Regulatory Interactions

  • Rv1152 in M. tuberculosis: This transcriptional regulator represses htpX and other vancomycin-responsive genes, linking protease activity to antibiotic resistance . Overexpression of Rv1152 in M. smegmatis increased tolerance to vancomycin, suggesting conserved regulatory pathways in mycobacteria .

Protease Activity Assays

  • In Vivo Models: A novel substrate system for E. coli HtpX enabled detection of proteolytic activity, with mutants showing reduced efficiency in conserved regions . This methodology could be adapted for M. bovis HtpX studies.

Challenges and Future Directions

While recombinant HtpX homologs provide valuable tools for research, gaps remain:

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; BCG_0608; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Target Names
htpX
Target Protein Sequence
MTWHPHANRLKTFLLLVGMSALIVAVGALFGRTALMLAALFAVGMNVYVYFNSDKLALRA MHAQPVSELQAPAMYRIVRELATSAHQPMPRLYISDTAAPNAFATGRNPRNAAVCCTTGI LRILNERELRAVLGHELSHVYNRDILISCVAGALAAVITALANMAMWAGMFGGNRDNANP FALLLVALLGPIAATVIRMAVSRSREYQADESGAVLTGDPLALASALRKISGGVQAAPLP PEPQLASQAHLMIANPFRAGERIGSLFSTHPPIEDRIRRLEAMARG
Uniprot No.

Target Background

Database Links

KEGG: mbb:BCG_0608

Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural classification and cellular localization of HtpX in Mycobacterium bovis?

HtpX is classified as a putative membrane-bound zinc metalloprotease that participates in the proteolytic quality control of membrane proteins. Structural studies indicate that HtpX proteins range from 279 to 336 amino acids in length and exhibit hydrophobic characteristics, allowing them to reside in and interact with biological membranes . Experimental localization studies using specific antibodies and Western blot assays have confirmed that HtpX is primarily detected in the cell extract rather than culture supernatant, consistent with its membrane-associated function . Unlike some other mycobacterial proteins that are secreted extracellularly, HtpX remains cell-associated, which has important implications for designing extraction protocols in recombinant production systems.

What biochemical properties characterize recombinant HtpX protein?

Recombinant HtpX proteins exhibit distinct physicochemical properties that influence their experimental handling and functional characteristics. Proteomic characterization has revealed that these proteins are:

PropertyCharacteristicExperimental Implications
pH RangeSlightly acidic to basicAffects buffer selection for optimal activity
Thermal StabilityHighResistant to denaturation during purification processes
HydrophobicityPronouncedRequires specialized solubilization strategies
Disorder Regions18.53-43.69%Provides functional flexibility for protein-protein interactions

These properties necessitate specific experimental considerations when working with recombinant HtpX, particularly in expression systems and purification protocols . The high percentage of disordered regions provides functional flexibility that enables the formation of macromolecular complexes and interaction with host cell receptors, which is crucial for understanding its biological role in mycobacterial pathogenesis.

How can HtpX be effectively cloned and expressed as a recombinant protein?

The expression of recombinant HtpX involves several methodological steps beginning with gene amplification. Based on established protocols for similar mycobacterial proteins, the htpX gene can be amplified by PCR and cloned into an expression vector such as pRSET-A to create a fusion with an N-terminal histidine tag . For optimal expression, E. coli BL21 is commonly employed as the host strain, allowing for controlled induction and high-yield production. The protein can then be purified under native conditions using nickel affinity chromatography.

When developing expression protocols for membrane-associated proteins like HtpX, researchers should consider:

  • Optimizing codon usage for the expression host

  • Determining ideal induction conditions (temperature, IPTG concentration, duration)

  • Implementing appropriate solubilization strategies to maintain the native conformation

  • Confirming expression through both Coomassie-stained polyacrylamide gels and Western blot analysis using antihistidine antibodies

This methodological approach ensures the production of functionally active recombinant protein suitable for downstream applications and structural studies.

How does HtpX interact with other mycobacterial proteins in functional pathways?

Protein-protein interaction analysis through STRING databases has revealed that HtpX functions within a complex network of protein interactions. Key functional partners identified include:

  • FtsH - Another zinc-dependent metalloprotease involved in protein quality control

  • Def - Peptide deformylase involved in protein maturation

  • Fmt - Methionyl-tRNA formyltransferase

  • Various Pnec proteins (Pnec_1775, Pnec_1774, Pnec_1773, etc.) involved in cellular metabolism

These interactions suggest that HtpX participates in coordinated protein quality control pathways that are essential for mycobacterial adaptation to environmental stresses. The interaction with FtsH is particularly significant as both are zinc-metalloproteases involved in membrane protein regulation, suggesting potential functional redundancy or cooperation in maintaining membrane proteostasis. Researchers investigating these pathways should consider experimental approaches that capture dynamic protein interactions under various stress conditions to fully elucidate HtpX's role in mycobacterial physiology.

What is the relationship between HtpX and antibiotic resistance in Mycobacterium species?

Emerging evidence indicates that HtpX may contribute to antibiotic resistance mechanisms in Mycobacterium species. Transcriptional regulation studies have demonstrated that HtpX is among four vancomycin-responsive genes negatively regulated by the GntR family transcriptional regulator Rv1152 in M. tuberculosis . When Rv1152 is overexpressed, decreased bacterial susceptibility to vancomycin is observed, suggesting that the regulation of HtpX and other proteins in this pathway directly influences antibiotic sensitivity.

This relationship positions HtpX as a potential target for adjuvant therapies aimed at enhancing antibiotic efficacy. Researchers investigating this connection should consider examining:

  • Transcriptional changes in htpX expression following antibiotic exposure

  • The impact of htpX knockout or overexpression on minimum inhibitory concentrations of various antibiotics

  • Potential synergistic effects between HtpX inhibitors and conventional antibiotics against drug-resistant strains

Understanding these interactions could lead to novel therapeutic strategies for combating increasing drug resistance in mycobacterial infections.

How can comparative proteomic approaches be applied to study evolutionary conservation of HtpX across mycobacterial species?

Comprehensive proteomic analysis of HtpX requires multilayered computational approaches to elucidate evolutionary relationships and functional conservation. A robust methodology involves:

  • Sequence retrieval from established databases (UniProt, NCBI)

  • Homology searches using specialized BLAST algorithms optimized for mycobacterial proteins

  • Multiple sequence alignment via CLUSTALW to identify conserved domains

  • Molecular phylogenetics using MEGA11 software to establish evolutionary relationships

  • Conservation analysis using ConSurf to identify functionally critical residues

This approach has revealed significant evolutionary insights into HtpX homologs. For example, studies suggest that Polynucleobacter necessarius may represent an ancestral relationship to mycobacterial HtpX proteins, with related organisms clustering together phylogenetically . The identification of 19 conserved and exposed residues alongside 38 conserved and buried residues provides critical information for structure-function analyses and rational drug design targeting conserved functional domains.

Researchers should prioritize examining patterns of conservation across pathogenic versus non-pathogenic mycobacterial species to identify adaptations specifically related to virulence and host-pathogen interactions.

What methodological approaches are most effective for assessing the immunogenicity of recombinant HtpX?

Assessment of HtpX immunogenicity requires sophisticated immunological methods that can distinguish between different arms of the immune response. Based on studies with related mycobacterial proteins, an effective methodological framework includes:

  • Cell-mediated immunity assessment:

    • Interferon-gamma (IFN-γ) release assays using PBMCs from infected hosts

    • T-cell proliferation assays with recombinant HtpX stimulation

    • Cytokine profiling to determine Th1/Th2 polarization

  • Humoral immunity evaluation:

    • ELISA-based detection of anti-HtpX antibodies in serum samples

    • Comparative analysis between infected and non-infected populations

    • Isotype determination to assess quality and functionality of antibody response

Evidence from related studies indicates that mycobacterial zinc-metalloproteases can elicit strong and specific humoral responses . For instance, HspX (another mycobacterial protein) effectively discriminates PPD skin test-positive from negative animals in bovine tuberculosis testing . This suggests that recombinant HtpX may similarly function as a diagnostic antigen or potential vaccine component.

When designing immunogenicity studies, researchers should include appropriate controls including:

  • Known immunogenic mycobacterial proteins (positive controls)

  • Non-mycobacterial proteins of similar structure (specificity controls)

  • Serial dilutions of antigens to establish dose-response relationships

What are the experimental challenges in resolving the three-dimensional structure of membrane-bound HtpX, and what alternative approaches can overcome these limitations?

Membrane proteins like HtpX present significant challenges for traditional structural biology techniques. The key experimental hurdles include:

  • Solubilization difficulties:

    • The hydrophobic nature of HtpX necessitates detergent-based extraction

    • Finding detergents that maintain native conformation without interfering with structural studies is challenging

  • Crystallization barriers:

    • Membrane proteins typically have lower crystallization success rates

    • The presence of disordered regions (18.53-43.69% in HtpX homologs) further complicates crystallization

  • NMR spectroscopy limitations:

    • Size constraints for solution NMR

    • Complex spectral interpretation due to detergent micelles

To overcome these challenges, researchers should consider alternative structural biology approaches:

TechniqueAdvantagesLimitationsResolution Potential
Cryo-electron microscopyWorks with membrane proteins in native-like environmentsRequires optimization for smaller proteinsNear-atomic resolution possible
Hydrogen-deuterium exchange MSMaps solvent-accessible regions and dynamicsIndirect structural informationResidue-level information
Computer modeling & simulationLeverages the 19 exposed and 38 buried conserved residuesRequires experimental validationDependent on template quality
Crosslinking mass spectrometryIdentifies spatial proximity of residuesDependent on crosslinker accessibilityDistance constraints between residues

Combining these approaches with biochemical studies of systematically generated mutants targeting the conserved residues would provide comprehensive structural insights even in the absence of high-resolution crystal structures.

How can recombinant HtpX be utilized in diagnostic assays for Mycobacterium bovis infection?

The potential of recombinant HtpX as a diagnostic antigen can be evaluated using established immunoassay frameworks. Comparative studies with other mycobacterial antigens suggest that specific proteins can effectively discriminate between infected and non-infected individuals . A methodological approach for developing HtpX-based diagnostics would include:

  • Optimization of recombinant HtpX production with preserved antigenic epitopes

  • Development of ELISA or lateral flow immunoassay formats using purified protein

  • Validation using serum panels from:

    • Confirmed M. bovis infected subjects

    • Healthy controls

    • Subjects with non-mycobacterial infections (to assess specificity)

    • Household contacts of infected individuals (to assess early detection potential)

The diagnostic potential of HtpX should be assessed both independently and in combination with other established antigens. Studies with HspX in bovine tuberculosis have shown promising results for distinguishing PPD skin test-positive from negative animals , suggesting that HtpX might similarly serve as a biomarker for infection status or disease progression.

Researchers should also investigate the potential of HtpX-based interferon-gamma release assays (IGRAs) as alternatives to current PPD-based tests, with particular attention to sensitivity across different stages of infection and in immunocompromised hosts.

What experimental design would best assess HtpX inhibitors as potential adjuvants for antimycobacterial therapy?

Given the association between HtpX regulation and antibiotic susceptibility , the development of HtpX inhibitors represents a promising approach for adjuvant therapy. A comprehensive experimental design to evaluate potential inhibitors would include:

  • In vitro screening phase:

    • Structure-based virtual screening targeting the conserved catalytic domain

    • Biochemical assays to confirm direct inhibition of proteolytic activity

    • Cellular assays to assess membrane permeability and target engagement

  • Combination therapy assessment:

    • Checkerboard assays to identify synergistic combinations with conventional antibiotics

    • Time-kill studies to characterize bactericidal versus bacteriostatic effects

    • Resistance development monitoring through serial passage experiments

  • Ex vivo and in vivo validation:

    • Macrophage infection models to assess intracellular efficacy

    • Animal models of infection to evaluate pharmacokinetics and efficacy

    • Histopathological analysis to assess granuloma penetration

The experimental design should specifically address whether HtpX inhibition can restore sensitivity to antibiotics in resistant strains, similar to the observed effects when disrupting the regulatory pathway involving Rv1152 . Given that inhibitors of Rv1152 might be ideal vancomycin adjuvants for controlling multi-drug resistant Mycobacterial infections , parallel assessment of HtpX inhibition would provide valuable comparative data on different intervention points in the same pathway.

How might single-cell proteomics advance our understanding of HtpX expression heterogeneity within mycobacterial populations?

Traditional bulk proteomics approaches may mask significant cell-to-cell variability in HtpX expression, potentially overlooking important aspects of functional heterogeneity within mycobacterial populations. Emerging single-cell proteomics techniques offer opportunities to address this limitation through:

  • Mass cytometry (CyTOF) with HtpX-specific antibodies to quantify expression at the single-cell level

  • Proximity ligation assays to visualize HtpX interactions with partner proteins in individual bacteria

  • Integration with single-cell transcriptomics to correlate protein expression with transcriptional programs

This approach could reveal distinct subpopulations with varying HtpX expression levels and potentially different functional states or antibiotic susceptibility profiles. Such heterogeneity might explain the persistence of mycobacterial infections despite antibiotic treatment and could identify new strategies for targeting bacterial subpopulations with altered stress responses.

Researchers pursuing this direction should develop protocols for gentle bacterial lysis that preserve spatial information and protein-protein interactions while enabling single-cell resolution measurements of membrane-associated proteins like HtpX.

What methodological approaches would best characterize the role of HtpX in host-pathogen interactions during granuloma formation?

Understanding HtpX's role in granuloma environments requires sophisticated in vitro and in vivo models that recapitulate key aspects of this complex microenvironment. A comprehensive research strategy would include:

  • Advanced in vitro granuloma models:

    • 3D cell culture systems with primary human cells

    • Microfluidic devices that create oxygen and nutrient gradients

    • Multi-cell type systems including macrophages, T cells, and fibroblasts

  • Genetic and biochemical approaches:

    • Conditional htpX knockout mycobacterial strains

    • Fluorescent reporter systems to monitor htpX expression during infection

    • Selective inhibitors to modulate HtpX activity at different infection stages

  • Advanced imaging techniques:

    • Correlative light and electron microscopy to visualize HtpX localization during infection

    • Intravital microscopy in animal models to track bacteria with varied htpX expression

This methodological framework would allow researchers to determine whether HtpX contributes to mycobacterial adaptation to the stressful granuloma environment, potentially explaining the bacteria's remarkable persistence in host tissues. The approach should specifically investigate whether HtpX-mediated membrane protein quality control becomes essential under the specific stresses encountered within granulomas, including hypoxia, nutrient limitation, and host immune effectors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.