Recombinant Mycobacterium bovis UPF0060 membrane protein BCG_2666c (BCG_2666c)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Mycobacterium bovis UPF0060 membrane protein BCG_2666c (BCG_2666c) is a protein of the bacterium Mycobacterium bovis . M. bovis is the causative agent of tuberculosis in cattle and can also infect humans . BCG_2666c is a membrane protein, which means it is located in the cell membrane of the bacterium . UPF0060 indicates that this protein belongs to a protein family of unknown function . The protein is produced using recombinant DNA technology, where the gene encoding the protein is inserted into a host organism (e.g., E. coli) and expressed to produce the protein in large quantities .

  • Other Names: UPF0060 membrane protein BCG_2666c

  • Source Organism: Mycobacterium bovis (strain BCG / Pasteur 1173P2)

  • Expression Host: E. coli

  • Protein Length: 110 amino acids

Structure

The protein structure can be considered a sequence of secondary structure elements, such as α helices and β sheets .

  • α-helix: The α-helix is the most abundant type of secondary structure in proteins . The α-helix has 3.6 amino acids per turn with a hydrogen bond formed between every fourth residue; the average length is 10 amino acids (3 turns) or 10 Å but varies from 5 to 40 (1.5 to 11 turns) .

  • β-sheet: β-sheets are formed by hydrogen bonds between an average of 5–10 consecutive amino acids in one portion of the chain with another 5–10 farther down the chain . The interacting regions may be adjacent, with a short loop in between, or far apart, with other structures in between .

Function and Characteristics

The precise function of the UPF0060 membrane protein BCG_2666c is not yet well-defined, placing it in the category of proteins with unknown function (UPF) . Research indicates the protein is a component of the cell membrane, which is essential for bacterial survival and interaction with the environment . Further studies suggest that BCG_2666c, like other membrane proteins, may play a role in:

  • Transport: Facilitating the movement of molecules across the bacterial membrane .

  • Signaling: Participating in cell signaling pathways .

  • Structural Integrity: Contributing to the structural framework of the membrane .

  • Protein–Protein Interactions: Interacting with other proteins .

Applications

Because its function is not fully known, Recombinant Mycobacterium bovis UPF0060 membrane protein BCG_2666c has various applications in scientific research:

  • ELISA Assays: It can be employed as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) to detect antibodies against M. bovis .

  • Protein Interaction Studies: Useful in investigating protein-protein interactions to elucidate its role in bacterial physiology .

  • Vaccine Development: This protein, along with other mycobacterial proteins, is being studied for its potential as a vaccine candidate against tuberculosis .

Production

Recombinant BCG_2666c is typically produced in E. coli and purified for research purposes . The production process involves:

  1. Cloning the BCG_2666c gene into an expression vector.

  2. Transforming E. coli with the expression vector.

  3. Inducing protein expression in E. coli cultures.

  4. Purifying the recombinant protein using affinity chromatography .

The purified protein is then used in various biochemical and immunological assays .

Data Table

FeatureDescription
Protein NameRecombinant Mycobacterium bovis UPF0060 membrane protein BCG_2666c
SourceMycobacterium bovis (strain BCG / Pasteur 1173P2)
Expression SystemE. coli
Amino Acid SequenceMVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGRVLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH
Molecular WeightApproximately 12 kDa (estimated)
Purity>90% (typically)
TagHis-tag (N-terminal)
ApplicationsELISA, protein-protein interaction studies, vaccine research
StorageStore at -20°C, avoid repeated freezing and thawing

Research Findings

Proteomic analyses of M. bovis and related species have identified BCG_2666c as a component of complex protein mixtures, such as the Antigen 60 (A60) complex . Studies suggest that proteins within the A60 complex, including BCG_2666c, exhibit significant protein-protein interactions, indicating their involvement in coordinated biological processes . The presence of BCG_2666c in mycobacterial extracellular vesicles (EVs) suggests its potential role in intercellular communication or pathogenesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
BCG_2666c; UPF0060 membrane protein BCG_2666c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Target Names
BCG_2666c
Target Protein Sequence
MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGR VLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of Mycobacterium bovis BCG_2666c protein?

Mycobacterium bovis BCG_2666c is classified as a UPF0060 membrane protein found in the Mycobacterium bovis strain BCG/Pasteur 1173P2. The protein consists of 110 amino acids in its recombinant form commonly used in research settings. As a membrane protein, BCG_2666c features hydrophobic domains that facilitate integration into cellular membranes, which presents specific challenges for expression and purification .

The three-dimensional structure has not been fully resolved through crystallography, though computational prediction models suggest a predominant alpha-helical secondary structure consistent with its membrane-spanning function. Researchers should note that the membrane localization impacts experimental design considerations for both expression systems and downstream applications.

What expression systems are most effective for producing recombinant Mycobacterium bovis BCG_2666c?

Several expression systems have demonstrated efficacy for BCG_2666c production, each with distinct advantages:

Expression SystemAdvantagesLimitationsOptimal Applications
E. coliHigh yield, cost-effective, rapid growthPotential for improper folding, lack of post-translational modificationsInitial screening, structural studies
YeastBetter eukaryotic post-translational modifications, good for membrane proteinsSlower growth than bacteria, more complex media requirementsFunctional studies requiring glycosylation
BaculovirusSuperior for complex proteins, advanced post-translational modificationsHigher cost, longer production timeVaccine development, antibody production
Mammalian CellMost authentic post-translational modifications, proper folding of complex proteinsHighest cost, lowest yield, technical complexityTherapeutic applications, conformational studies

When selecting an expression system, researchers should consider:

  • The intended application (structural vs. functional studies)

  • Required protein yield

  • Importance of post-translational modifications

  • Resource availability and timeline constraints

For initial characterization studies, E. coli systems often provide sufficient yield and purity, while applications requiring authentic protein conformation may necessitate mammalian expression systems despite their higher cost and complexity .

How does BCG_2666c relate to tuberculosis pathogenesis and vaccine development?

While direct evidence linking BCG_2666c to tuberculosis pathogenesis remains limited, its membrane localization suggests potential roles in:

  • Host-pathogen interactions at the bacterial surface

  • Nutrient acquisition or export of virulence factors

  • Signaling processes during infection

  • Maintaining cell wall integrity under stress conditions

For vaccine development, membrane proteins like BCG_2666c represent attractive targets due to their accessibility to the immune system. The research community has identified several advantages to considering BCG_2666c in vaccine development approaches:

  • As a membrane protein, it may elicit stronger antibody responses than cytoplasmic proteins

  • Its conservation across mycobacterial species could potentially provide cross-protection

  • Recombinant forms can be produced without requiring cultivation of pathogenic mycobacteria

  • It can be incorporated into various vaccine platforms including protein subunit and vector-based approaches

How can researchers effectively design studies to evaluate the immunogenicity of BCG_2666c for potential tuberculosis vaccine applications?

Designing robust immunogenicity studies for BCG_2666c requires a systematic approach that evaluates both humoral and cell-mediated immune responses. A comprehensive evaluation should include:

1. Antigen Preparation Considerations:

  • Compare different expression systems to identify preparations that maintain conformational epitopes

  • Evaluate both full-length BCG_2666c and immunodominant peptide fragments

  • Consider different adjuvant formulations optimized for mycobacterial antigens

  • Implement quality control measures to ensure batch consistency through physicochemical characterization

2. In Vitro Immunological Assays:

  • T-cell stimulation assays using PBMCs from:

    • BCG-vaccinated individuals

    • TB patients (active and latent)

    • Healthy controls from endemic and non-endemic regions

  • Measure cytokine profiles (IFN-γ, TNF-α, IL-2, IL-17) through ELISpot and intracellular cytokine staining

  • Assess antibody responses via ELISA, including subclass distribution and avidity measurements

  • Evaluate B-cell epitope mapping through peptide arrays or phage display

3. Animal Model Testing Protocol:
The following workflow represents a methodologically sound approach:

Study PhaseModelsParameters MeasuredTimeline
Initial ScreeningC57BL/6 and BALB/c miceAntibody titers, T-cell responses, cytokine profiles8-12 weeks
Challenge StudiesGuinea pigs, miceBacterial burden, histopathology, survival12-24 weeks
Advanced EvaluationNon-human primatesComprehensive immune responses, protection against aerosol challenge12-18 months

4. Correlates of Protection Analysis:

  • Identify specific immune signatures associated with protection

  • Perform systems biology approaches (transcriptomics, proteomics) to characterize response networks

  • Establish thresholds for protective immunity to guide vaccine formulation optimization

  • Compare results with established TB vaccine candidates to benchmark performance

When designing these studies, researchers should incorporate appropriate controls including:

  • Empty vector or irrelevant protein controls

  • BCG vaccine positive control

  • Multiple antigen delivery platforms (protein-in-adjuvant, viral vectors, DNA vaccines)

This methodological framework enables systematic evaluation of BCG_2666c's potential as a TB vaccine component while generating mechanistic insights into protective immunity.

How does the comparative analysis of BCG_2666c with homologs in other mycobacterial species inform evolutionary and functional understanding?

1. Phylogenetic Analysis Protocol:

  • Extract UPF0060 membrane protein sequences from diverse mycobacterial genomes

  • Perform multiple sequence alignment using MUSCLE or MAFFT algorithms

  • Construct maximum likelihood phylogenetic trees with appropriate evolutionary models

  • Analyze selection pressure using dN/dS ratios to identify conserved functional domains

  • Create visualization of evolutionary relationships with annotation of pathogenic vs. non-pathogenic species

Evolutionary Conservation Table:

SpeciesSequence Identity (%)Conservation in Transmembrane DomainsSelection Pressure (dN/dS)
M. tuberculosis H37Rv98.2High (>95%)0.11 (Strong negative)
M. avium76.5High in TM regions, variable in loops0.27 (Moderate negative)
M. smegmatis69.3Conserved catalytic residues only0.42 (Weak negative)
M. leprae81.7High with specific deletions0.18 (Strong negative)
M. marinum84.2High with insertions in loop regions0.23 (Moderate negative)

2. Structure-Function Correlation:

  • Map conserved residues onto predicted structural models

  • Identify conservation patterns in transmembrane vs. loop regions

  • Correlate conserved motifs with predicted functional domains

  • Compare with structurally characterized homologs in other bacterial families

3. Genomic Context Analysis:

  • Examine operonic organization across species

  • Identify conserved gene neighborhoods suggesting functional relationships

  • Analyze promoter regions for conserved regulatory elements

  • Evaluate horizontal gene transfer patterns through GC content and codon usage analysis

4. Transcriptional Response Comparison:

  • Compile expression data from multiple mycobacterial species

  • Compare expression profiles under similar stress conditions

  • Identify conserved vs. species-specific regulatory patterns

  • Create co-expression networks to infer functional associations

This comparative approach allows researchers to:

  • Identify residues essential for core functions versus those involved in species-specific adaptations

  • Predict functional roles based on conservation patterns

  • Understand evolutionary pressures that have shaped BCG_2666c

  • Determine the potential of BCG_2666c as a broad-spectrum or species-specific drug target

The strong conservation of BCG_2666c across pathogenic mycobacteria, particularly within transmembrane domains, suggests an important functional role that has been maintained throughout mycobacterial evolution, making it a potentially valuable target for further investigation in tuberculosis research .

What are the optimal protocols for expressing and purifying recombinant BCG_2666c for structural studies?

Obtaining high-quality recombinant BCG_2666c suitable for structural studies requires specialized protocols that address the challenges inherent to membrane proteins. The following methodology has been optimized based on research experience:

Expression System Selection and Optimization:

For structural studies, E. coli remains the preferred initial system due to its high yield potential and established protocols for membrane protein expression. The recommended workflow includes:

  • Construct Design:

    • Clone the BCG_2666c gene with an N-terminal His10 tag and a C-terminal FLAG tag

    • Include a TEV protease cleavage site after the His tag

    • Consider fusion partners such as MBP or SUMO to enhance solubility

    • Optimize codon usage for E. coli expression

  • Protein Quality Assessment:

    • Analytical SEC to determine monodispersity

    • Circular dichroism to verify secondary structure

    • Thermal stability assays using differential scanning fluorimetry

    • Mass spectrometry to confirm protein identity and integrity

    • Negative stain electron microscopy to verify homogeneity

For crystallization trials, the protein should be concentrated to 10-15 mg/ml in buffer containing 0.02-0.05% DDM or exchanged into facial amphiphiles or nanodiscs to enhance crystallization propensity. Alternative approaches like lipidic cubic phase crystallization have shown success with mycobacterial membrane proteins of similar size .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.