Recombinant Mycobacterium bovis UPF0060 membrane protein JTY_2660, also referred to as JTY_2660, is a protein derived from the Mycobacterium bovis BCG strain Tokyo 172 / ATCC 35737 / TMC 1019 . JTY_2660 is a membrane protein that contains 110 amino acids . The protein is tagged, but the specific tag type is determined during the production process .
The amino acid sequence for Recombinant Mycobacterium bovis UPF0060 membrane protein JTY_2660 is :
MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGRVLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH
Molecular Weight: The molecular weight of the protein can be predicted based on its amino acid sequence, though the exact weight may vary with post-translational modifications or the presence of tags.
Expression Region: The protein is expressed from amino acid residues 1-110, representing the full-length protein .
Storage: It is recommended to store the protein at -20°C for extended storage, or at -80°C . Repeated freezing and thawing cycles should be avoided, and working aliquots can be stored at 4°C for up to one week . The protein is typically stored in a Tris-based buffer with 50% glycerol, optimized for the protein .
Many M. bovis open reading frames (ORFs) have been produced as recombinant proteins to create resources suitable for developing effective vaccines against bovine tuberculosis (bTB) . Creating recombinant forms of proteins can be challenging, with issues in expression and purification . Different strategies, like varying the position of the His tag (N-terminal or C-terminal) or using solubility tags such as GFP, SUMO, or GB1, have been employed to enhance expression or purification .
Expression Systems: E. coli and recombinant baculoviruses are commonly used as expression systems to maximize the possibility of efficient expression of a diverse range of selected M. bovis ORFs as soluble proteins .
Purification: Screening of clones or recombinant viruses is typically performed using Western blot with an antibody that recognizes the polyhistidine tag .
Recombinant Mycobacterium bovis proteins are valuable tools in immunological research, particularly in the context of bovine tuberculosis (bTB) .
Vaccine Development: These proteins can be used in test immunizations to develop effective bTB vaccines .
Immune Response Studies: Recombinant proteins can help characterize the immune responses, as demonstrated by studies evaluating recombinant Mycobacterium bovis BCG expressing proteins from other pathogens .
Protein-Protein Interactions: They can elucidate protein-protein interactions, which is crucial for understanding the function and regulation of bacterial processes .
KEGG: mbt:JTY_2660
JTY_2660 is classified as a UPF0060 membrane protein from Mycobacterium bovis. It is a relatively small protein consisting of 110 amino acids in its full-length form. The recombinant version is commonly produced with an N-terminal His-tag to facilitate purification and experimental applications. The protein belongs to the UPF0060 family, which contains uncharacterized protein families (UPF) whose functions have not been fully elucidated. JTY_2660 has the UniProt ID C1AFB2 and is associated with mycobacterial membrane systems, suggesting potential roles in membrane integrity, transport, or signaling processes. Understanding this protein may provide insights into mycobacterial biology and potentially offer new targets for antimycobacterial drug development .
Proper reconstitution and storage are critical for maintaining the integrity and activity of JTY_2660 protein. The recommended protocol for reconstitution is:
Briefly centrifuge the vial prior to opening to bring the lyophilized contents to the bottom
Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL
Add glycerol to a final concentration of 5-50% (with 50% being commonly recommended) to enhance stability during freeze-thaw cycles
Aliquot the reconstituted protein into smaller volumes to minimize freeze-thaw cycles
For storage:
Store lyophilized powder at -20°C/-80°C (shelf life approximately 12 months)
Store reconstituted protein at -20°C/-80°C (shelf life approximately 6 months)
Working aliquots can be stored at 4°C for up to one week
Avoid repeated freeze-thaw cycles as these significantly reduce protein stability and activity
It's advisable to validate protein integrity after reconstitution using methods such as SDS-PAGE or activity assays specific to the research application .
Verification of JTY_2660 purity and integrity is essential before conducting experiments. Standard methods include:
SDS-PAGE analysis: Commercial preparations typically achieve >85-90% purity as determined by SDS-PAGE. Researchers should confirm this by running their own gel to visualize a predominant band at approximately 12-15 kDa (the expected size of JTY_2660 plus the His-tag).
Western blotting: Using anti-His antibodies to detect the His-tagged protein can confirm the presence of the full-length protein.
Mass spectrometry: For more detailed analysis, mass spectrometry can verify the exact molecular weight and confirm the protein identity.
Circular dichroism: This technique can provide information about the secondary structure of the protein, which is particularly relevant for membrane proteins that may misfold when not in their native environment.
Limited proteolysis: This can assess whether the protein is properly folded, as misfolded proteins often show altered proteolytic patterns.
For membrane proteins like JTY_2660, additional considerations include assessing the protein's behavior in detergent micelles or lipid environments, which may be more representative of its native state .
Recombinant JTY_2660 can be produced in different expression systems, each with advantages and limitations:
Expression optimization typically involves testing different:
Induction conditions (temperature, inducer concentration, duration)
Host strains (particularly those optimized for membrane protein expression)
Fusion tags (His-tag position and linker composition)
Media formulations and additives
The choice of expression system should align with the intended research application and the specific requirements for protein folding and modifications .
JTY_2660 can be strategically incorporated into antimycobacterial screening workflows by leveraging reporter systems and biochemical assays. One sophisticated approach involves using dual-reporter systems in recombinant M. bovis BCG strains. This method utilizes two reporter genes (such as firefly and Renilla luciferase) under different promoter controls – one constitutive and one pathway-specific. This dual-reporter approach enables simultaneous screening for both broad antimycobacterial activity and pathway-specific inhibition.
For JTY_2660-specific applications, researchers could:
Develop assays that monitor JTY_2660 expression or stability in response to compound treatment
Create fusion constructs between JTY_2660 and reporter proteins to monitor localization or interactions
Design competitive binding assays to identify compounds that interact directly with JTY_2660
The dual-luciferase reporter system described in the literature for M. bovis BCG provides a particularly valuable platform as it allows high-throughput screening capabilities while still providing mechanistic insights. When the firefly luciferase activity decreases, it indicates general growth inhibition, while changes in Renilla luciferase activity can reveal pathway-specific effects. Such systems could be adapted to study JTY_2660 by placing its expression under the control of relevant promoters or by measuring its interaction with other proteins in the presence of potential inhibitors .
Structural characterization of membrane proteins like JTY_2660 presents significant challenges but can yield invaluable insights. The most effective techniques include:
X-ray crystallography: Requires obtaining well-diffracting crystals, which is challenging for membrane proteins. Success typically depends on:
Protein engineering to improve crystallizability (e.g., removal of flexible regions)
Selection of appropriate detergents or lipidic cubic phase methods
Addition of stabilizing antibody fragments or other binding partners
Cryo-electron microscopy (cryo-EM): Increasingly powerful for membrane protein structures, especially when incorporated into nanodiscs or other membrane mimetics.
Nuclear magnetic resonance (NMR) spectroscopy: Suitable for smaller membrane proteins or domains, providing dynamic information as well as structure.
Computational approaches:
Homology modeling based on related UPF0060 family proteins
Molecular dynamics simulations to predict membrane interactions
AlphaFold2 or similar AI-based structure prediction
Hybrid approaches combining low-resolution experimental data with computational modeling.
For JTY_2660 specifically, its relatively small size (110 amino acids) makes it potentially amenable to solution NMR studies if it can be stabilized in suitable membrane mimetics. Alternatively, incorporation into nanodiscs followed by cryo-EM analysis might provide structural insights with less demanding sample preparation than crystallography .
While direct evidence linking JTY_2660 to pathogenesis remains limited, several lines of reasoning suggest potential roles:
Membrane localization: As a membrane protein, JTY_2660 may participate in host-pathogen interactions, environmental sensing, or maintenance of membrane integrity under stress conditions.
Conservation: If JTY_2660 is conserved across pathogenic mycobacterial species, this would suggest functional importance.
Expression patterns: Analysis of when and where JTY_2660 is expressed during infection could provide clues to its role. Upregulation during specific phases of infection would suggest involvement in pathogenesis.
Structural features: The amino acid sequence suggests multiple transmembrane domains, which could indicate roles in:
Transport of nutrients or virulence factors
Sensing environmental cues or host defense mechanisms
Maintaining membrane integrity during infection
Interaction partners: Identifying proteins that interact with JTY_2660 could reveal its role in virulence networks.
Research approaches to investigate pathogenesis connections might include:
Gene knockout or knockdown studies to assess virulence in cellular or animal models
Expression analysis during different phases of infection
Protein-protein interaction studies to identify binding partners
Localization studies during infection using fluorescent tags or immunolocalization
These investigations would significantly advance our understanding of JTY_2660's biological role and potentially identify new targets for therapeutic intervention .
Reporter systems offer powerful tools for studying JTY_2660 regulation and function through various sophisticated approaches:
Optimization considerations include:
Careful selection of linkers between JTY_2660 and reporter proteins to maintain function
Validation that reporter fusions maintain proper localization and don't disrupt function
Selection of appropriate reporters based on sensitivity, dynamic range, and compatibility with experimental conditions
Design of controls to distinguish specific effects from general stress responses
These reporter approaches can be particularly valuable when studying membrane proteins like JTY_2660, where direct biochemical analysis may be challenging .
JTY_2660's function likely depends on interactions with other proteins within the mycobacterial membrane environment. Potential interaction partners and investigation methods include:
Predicted interaction types:
Other membrane proteins in functional complexes
Proteins involved in cell wall synthesis or maintenance
Signaling proteins that might dock to the cytoplasmic domains
Transport-associated proteins if JTY_2660 participates in membrane transport
Investigation methods:
Co-immunoprecipitation with tagged JTY_2660 followed by mass spectrometry
Bacterial two-hybrid systems adapted for membrane proteins
Proximity labeling approaches (BioID, APEX) to identify proteins in the vicinity
Cross-linking mass spectrometry to capture transient interactions
Surface plasmon resonance or microscale thermophoresis for validating specific interactions
Bioinformatic prediction approaches:
Analyzing gene neighborhood and operonic structure
Examining phylogenetic co-occurrence patterns
Structural docking predictions between JTY_2660 and potential partners
Functional validation of interactions:
Genetic knockout of interaction partners to assess phenotypic consequences
Mutational analysis of predicted interaction interfaces
Functional complementation assays
Understanding these interactions would provide significant insights into JTY_2660's biological role and potential as a drug target. Interaction mapping could reveal whether JTY_2660 functions as part of larger protein complexes or primarily through interactions with membrane lipids or small molecules .
Working with membrane proteins like JTY_2660 requires special methodological considerations to maintain native structure and function:
Solubilization strategies:
Selection of appropriate detergents (mild non-ionic detergents like DDM or LMNG often work well)
Detergent concentration optimization to prevent aggregation or denaturation
Alternative solubilization approaches like styrene-maleic acid copolymer (SMA) lipid particles
Nanodiscs or liposome reconstitution for functional studies
Buffer optimization:
pH conditions that maintain stability (typically pH 7.0-8.0 for mycobacterial proteins)
Ionic strength considerations (150-300 mM NaCl typical starting point)
Addition of stabilizing agents (glycerol, specific lipids, cholesterol)
Testing different buffering agents (Tris, HEPES, phosphate)
Experimental design adaptations:
Temperature sensitivity (membrane proteins often more stable at lower temperatures)
Longer equilibration times for binding and interaction studies
Control experiments with appropriate membrane protein controls
Careful interpretation of results in the context of the membrane environment
Analytical considerations:
Modified protocols for SDS-PAGE (sample heating conditions, loading buffers)
Specialized mass spectrometry approaches for membrane proteins
Careful design of constructs for structural biology applications
These considerations should be systematically addressed when designing experiments involving JTY_2660, with preliminary optimization studies to establish conditions that maintain the protein in a native-like, functional state .
Designing robust control experiments is critical for rigorous JTY_2660 research:
Negative controls:
Empty vector or non-expressing cells for background determination
Heat-denatured JTY_2660 to distinguish specific from non-specific effects
Irrelevant membrane proteins of similar size/properties to control for general membrane effects
Buffer-only controls containing all components except JTY_2660
Positive controls:
Well-characterized membrane proteins from the same family if available
Proteins with known interactions or activities to validate assay functionality
Tagged versions of JTY_2660 with confirmed activity
Validation controls:
Multiple detection methods to confirm observations (e.g., both fluorescence and western blotting)
Dose-response relationships to establish specificity
Competition experiments with unlabeled protein
Mutant versions of JTY_2660 with predicted loss of specific functions
System-specific controls:
For reporter systems: controls for cell viability and general transcription/translation
For binding studies: non-specific binding surfaces or proteins
For localization studies: markers for specific cellular compartments
For antimicrobial testing: established antimycobacterial compounds with known mechanisms
A particularly valuable approach is to design control experiments that can distinguish between effects on JTY_2660 specifically versus general effects on membrane proteins or cellular processes. This typically involves parallel experiments with other membrane proteins that are not expected to share the specific function being investigated .
Functional assays for membrane proteins present unique challenges and require specialized approaches:
Maintaining native environment:
Reconstitution into liposomes or nanodiscs to provide a lipid bilayer environment
Careful selection of lipid composition to mimic mycobacterial membranes
Temperature and pH conditions that reflect physiological conditions for mycobacteria
Consideration of membrane potential or pH gradients if relevant to function
Transport assays (if JTY_2660 has transport functions):
Liposome-based flux assays with encapsulated fluorescent indicators
Counterflow assays to measure exchange activities
Patch-clamp approaches if ion channel activity is suspected
Radiolabeled substrate transport measurements
Binding assays:
Surface plasmon resonance with careful immobilization strategies
Microscale thermophoresis in detergent micelles or nanodiscs
Fluorescence-based binding assays with environment-sensitive probes
Isothermal titration calorimetry adapted for membrane proteins
Structural dynamics:
Hydrogen-deuterium exchange mass spectrometry to measure conformational changes
Site-directed spin labeling combined with EPR spectroscopy
FRET-based approaches to monitor distance changes between domains
In-cell functional assays:
Growth complementation in knockout strains
Reporter systems linked to specific cellular processes
Phenotypic assays measuring changes in cell morphology or stress resistance
Validation across multiple assay types is particularly important for membrane proteins, as artifacts related to detergent, lipid composition, or protein orientation can significantly impact results .
Troubleshooting JTY_2660 experiments requires systematic approaches to address common challenges:
Poor protein yield or purity:
Optimize expression conditions (temperature, induction time, media composition)
Test different detergents or solubilization strategies
Modify purification protocols (imidazole concentration, wash steps)
Consider alternative expression systems or fusion tags
Evaluate codon optimization for the expression host
Protein aggregation:
Perform detergent screening to identify optimal solubilization conditions
Add stabilizing agents (glycerol, specific lipids, cholesterol)
Reduce protein concentration during handling
Explore buffer optimization (pH, salt concentration, additives)
Consider size exclusion chromatography to remove aggregates
Loss of activity:
Minimize freeze-thaw cycles
Test activity immediately after purification
Validate proper folding using biophysical methods
Consider native purification conditions (avoiding harsh denaturants)
Maintain cold chain throughout purification
Inconsistent results:
Standardize protein quantification methods
Establish quality control metrics for each preparation
Implement rigorous control experiments
Use internal standards for normalization
Document detailed protocols with all parameters
Technical approaches for verification:
Circular dichroism to assess secondary structure
Fluorescent size exclusion chromatography to evaluate aggregation state
Thermal shift assays to measure stability under different conditions
Limited proteolysis to confirm proper folding
Maintaining a systematic troubleshooting log and implementing standardized quality control metrics for each protein preparation can significantly improve experimental reproducibility when working with challenging membrane proteins like JTY_2660 .
Identifying small molecule interactions with JTY_2660 requires specialized techniques that account for its membrane protein nature:
Biophysical binding assays:
Surface plasmon resonance with immobilized JTY_2660
Microscale thermophoresis in detergent micelles or nanodiscs
Isothermal titration calorimetry for thermodynamic parameters
Fluorescence-based thermal shift assays to detect stabilizing compounds
Structural approaches:
X-ray crystallography with soaked or co-crystallized compounds
Cryo-EM to visualize compound binding
NMR-based fragment screening (HSQC perturbation)
Hydrogen-deuterium exchange mass spectrometry to identify binding regions
Functional screening:
Competition assays with known ligands if identified
Activity modulation assays if functional readouts are available
Cellular assays monitoring JTY_2660-dependent phenotypes
Reporter systems linked to JTY_2660 function or expression
Computational approaches:
Molecular docking if structural information is available
Pharmacophore modeling based on identified ligands
Virtual screening of compound libraries
Molecular dynamics simulations to identify potential binding pockets
Target validation methods:
Resistant mutant generation and characterization
Structure-activity relationship studies with compound analogs
Photoaffinity labeling to confirm binding sites
Cellular thermal shift assays (CETSA) to verify target engagement
The dual-reporter systems described for antimycobacterial screening could be particularly valuable for JTY_2660-focused studies, as they can distinguish between general growth inhibition and pathway-specific effects that might relate to JTY_2660 function .
JTY_2660 offers a valuable model system for understanding fundamental aspects of mycobacterial membrane biology through several experimental applications:
Membrane organization studies:
Localization studies using fluorescently tagged JTY_2660
Analysis of membrane microdomain association
Investigation of protein-lipid interactions specific to mycobacterial membranes
Examination of membrane protein turnover and trafficking
Comparative biology approaches:
Analysis of JTY_2660 conservation across mycobacterial species
Functional comparison with homologs from non-pathogenic mycobacteria
Investigation of adaptations specific to pathogenic species
Evolutionary analysis of UPF0060 family proteins
Membrane stress response investigations:
Monitoring JTY_2660 expression under various stress conditions
Assessing changes in localization or interactions during stress
Evaluating phenotypic consequences of JTY_2660 depletion under stress
Identifying stress-induced post-translational modifications
Membrane biogenesis insights:
Tracking JTY_2660 during cell division and membrane extension
Examining interactions with cell wall synthesis machinery
Investigating potential roles in maintaining membrane asymmetry
Studying incorporation into newly synthesized membrane regions
These studies could employ advanced techniques such as:
Super-resolution microscopy to visualize membrane organization
Lipidomics to detect JTY_2660-dependent changes in membrane composition
Crosslinking mass spectrometry to map the membrane protein interactome
Cryo-electron tomography to examine membrane ultrastructure
By serving as a specific probe for mycobacterial membranes, JTY_2660 studies can provide insights into the unique properties that distinguish these membranes from those of other bacteria, potentially revealing new targets for antimycobacterial intervention .
JTY_2660 can serve as a key component in innovative antimycobacterial screening platforms:
Target-based screening approaches:
Direct binding assays to identify compounds interacting with JTY_2660
Functional assays if specific activities can be established
Displacement assays with known ligands or lipids
Fragment-based screening to identify chemical starting points
Pathway-based reporter systems:
Integration into dual-reporter systems similar to the described BCG strain
Development of JTY_2660 promoter-driven reporters to monitor expression changes
Creation of reporter systems that detect JTY_2660 mislocalization or degradation
Biosensors that report on JTY_2660-dependent cellular processes
Phenotypic screening enhancements:
JTY_2660 knockout or knockdown strains for differential screening
Strains with modified JTY_2660 expression to identify sensitizing conditions
Conditional expression systems to validate JTY_2660 as the target of hits
Fluorescent tagging to monitor effects on localization or stability
High-throughput adaptation strategies:
Miniaturization to 384- or 1536-well formats
Development of homogeneous assay formats (no-wash detection)
Adaptation for automated liquid handling and analysis
Creation of image-based high-content screening approaches
The dual-luciferase reporter system described for M. bovis BCG provides a particularly promising platform that could be adapted to incorporate JTY_2660-specific readouts. This system allows simultaneous assessment of general growth inhibition through one reporter while using a second reporter to monitor pathway-specific effects, potentially including those involving JTY_2660 .
JTY_2660 presents both challenges and opportunities for structural biology studies of mycobacterial membrane proteins:
Structure determination approaches:
X-ray crystallography with specialized crystallization techniques:
Lipidic cubic phase crystallization
Detergent screening for optimal solubilization
Addition of antibody fragments to create crystal contacts
Cryo-EM studies:
Incorporation into nanodiscs or amphipols
Use of Fab fragments to increase particle size
Application of image processing algorithms for small membrane proteins
NMR spectroscopy:
Solution NMR with detergent-solubilized protein
Solid-state NMR in lipid bilayers
Selective isotope labeling to focus on specific regions
Sample preparation strategies:
Construct optimization:
Removal of flexible regions
Introduction of thermostabilizing mutations
Fusion to crystallization chaperones
Expression optimization:
Testing specialized expression systems for membrane proteins
Codon optimization for high-level expression
Co-expression with chaperones or binding partners
Purification approaches:
Tandem affinity purification for highest purity
Size exclusion chromatography to ensure monodispersity
On-column detergent exchange protocols
Methodological innovations:
Combining computational prediction with experimental validation
Hybrid methods integrating low-resolution experimental data with modeling
Serial crystallography at X-ray free-electron lasers for small crystals
Integrative structural biology approaches combining multiple techniques
Given JTY_2660's relatively small size (110 amino acids), it may be an excellent candidate for solution NMR studies if it can be maintained in a stable, monodisperse state in detergent micelles or nanodiscs. Additionally, its modest size makes it potentially amenable to computational structure prediction methods like AlphaFold2, which have shown increasing accuracy for membrane proteins .
Comparative analysis of JTY_2660 across mycobacterial species can yield valuable insights into evolution, function, and potential as a drug target:
Evolutionary insights:
Sequence conservation patterns across pathogenic and non-pathogenic mycobacteria
Identification of highly conserved residues suggesting functional importance
Detection of positive selection signatures that might indicate host adaptation
Phylogenetic analysis to trace the evolution of JTY_2660 within the Mycobacterium genus
Structural comparative analysis:
Prediction of structural conservation versus variability
Identification of species-specific insertions or deletions
Analysis of conservation in predicted functional domains or motifs
Comparison of predicted transmembrane topology across species
Functional implications:
Correlation of sequence variations with phenotypic differences between species
Assessment of expression pattern conservation across species
Investigation of potential co-evolution with interacting partners
Comparison of regulation mechanisms between species
Experimental approaches:
Cross-species complementation studies to test functional conservation
Domain swapping between homologs to identify species-specific functional regions
Comparative resistance profiles to antimicrobial compounds
Systematic mutagenesis guided by comparative sequence analysis
A particularly valuable approach would be to compare JTY_2660 between M. bovis, M. tuberculosis, and non-pathogenic mycobacteria like M. smegmatis to identify features that might be specifically relevant to pathogenesis. Additionally, comparing the genomic context and operonic structure across species could provide clues to functional associations and biological pathways involving JTY_2660 .
JTY_2660 offers several applications in genetic manipulation studies of mycobacteria:
Gene knockout/knockdown approaches:
CRISPR-Cas9 based deletion or disruption of JTY_2660
Antisense RNA or CRISPRi for conditional depletion
Unmarked deletion using specialized mycobacterial recombineering systems
Transposon mutagenesis to assess essentiality under various conditions
Gene overexpression systems:
Inducible promoters (tetracycline-responsive, acetamide-inducible)
Constitutive expression with varying promoter strengths
Episomal versus integrative expression constructs
Fusion to degradation tags for controlled protein levels
Reporter fusion applications:
Transcriptional fusions to study promoter activity and regulation
Translational fusions to monitor protein levels and localization
Split protein complementation to study protein-protein interactions
FRET-based approaches to examine conformational changes
Advanced genetic manipulation strategies:
Site-directed mutagenesis to identify critical residues
Domain swapping with homologs to determine functional regions
Introduction of regulated degradation domains for temporal control
Recombineering approaches for subtle chromosomal modifications
Genome editing considerations specific to mycobacteria:
Optimization for low transformation efficiency
Strategies to overcome mycobacterial DNA restriction systems
Specialized selection markers and counterselection systems
Methods for confirming genetic modifications in slow-growing species
The dual reporter system described in the literature for M. bovis BCG represents a sophisticated genetic manipulation approach that could be adapted to study JTY_2660 function or regulation. By combining constitutive and inducible reporters, researchers can monitor both general cellular effects and specific responses related to JTY_2660 pathways .