Recombinant Mycobacterium bovis UPF0060 membrane protein JTY_2660 (JTY_2660)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Mycobacterium bovis UPF0060 membrane protein JTY_2660, also referred to as JTY_2660, is a protein derived from the Mycobacterium bovis BCG strain Tokyo 172 / ATCC 35737 / TMC 1019 . JTY_2660 is a membrane protein that contains 110 amino acids . The protein is tagged, but the specific tag type is determined during the production process .

Protein Sequence and Characteristics

The amino acid sequence for Recombinant Mycobacterium bovis UPF0060 membrane protein JTY_2660 is :
MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGRVLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH

  • Molecular Weight: The molecular weight of the protein can be predicted based on its amino acid sequence, though the exact weight may vary with post-translational modifications or the presence of tags.

  • Expression Region: The protein is expressed from amino acid residues 1-110, representing the full-length protein .

  • Storage: It is recommended to store the protein at -20°C for extended storage, or at -80°C . Repeated freezing and thawing cycles should be avoided, and working aliquots can be stored at 4°C for up to one week . The protein is typically stored in a Tris-based buffer with 50% glycerol, optimized for the protein .

  • UniProt Accession Number: C1AFB2

Recombinant Protein Production

Many M. bovis open reading frames (ORFs) have been produced as recombinant proteins to create resources suitable for developing effective vaccines against bovine tuberculosis (bTB) . Creating recombinant forms of proteins can be challenging, with issues in expression and purification . Different strategies, like varying the position of the His tag (N-terminal or C-terminal) or using solubility tags such as GFP, SUMO, or GB1, have been employed to enhance expression or purification .

  • Expression Systems: E. coli and recombinant baculoviruses are commonly used as expression systems to maximize the possibility of efficient expression of a diverse range of selected M. bovis ORFs as soluble proteins .

  • Purification: Screening of clones or recombinant viruses is typically performed using Western blot with an antibody that recognizes the polyhistidine tag .

Research Applications

Recombinant Mycobacterium bovis proteins are valuable tools in immunological research, particularly in the context of bovine tuberculosis (bTB) .

  • Vaccine Development: These proteins can be used in test immunizations to develop effective bTB vaccines .

  • Immune Response Studies: Recombinant proteins can help characterize the immune responses, as demonstrated by studies evaluating recombinant Mycobacterium bovis BCG expressing proteins from other pathogens .

  • Protein-Protein Interactions: They can elucidate protein-protein interactions, which is crucial for understanding the function and regulation of bacterial processes .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
JTY_2660; UPF0060 membrane protein JTY_2660
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
Target Names
JTY_2660
Target Protein Sequence
MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGR VLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH
Uniprot No.

Target Background

Database Links

KEGG: mbt:JTY_2660

Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is JTY_2660 and what is its basic characterization?

JTY_2660 is classified as a UPF0060 membrane protein from Mycobacterium bovis. It is a relatively small protein consisting of 110 amino acids in its full-length form. The recombinant version is commonly produced with an N-terminal His-tag to facilitate purification and experimental applications. The protein belongs to the UPF0060 family, which contains uncharacterized protein families (UPF) whose functions have not been fully elucidated. JTY_2660 has the UniProt ID C1AFB2 and is associated with mycobacterial membrane systems, suggesting potential roles in membrane integrity, transport, or signaling processes. Understanding this protein may provide insights into mycobacterial biology and potentially offer new targets for antimycobacterial drug development .

How should researchers properly reconstitute and store recombinant JTY_2660?

Proper reconstitution and storage are critical for maintaining the integrity and activity of JTY_2660 protein. The recommended protocol for reconstitution is:

  • Briefly centrifuge the vial prior to opening to bring the lyophilized contents to the bottom

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being commonly recommended) to enhance stability during freeze-thaw cycles

  • Aliquot the reconstituted protein into smaller volumes to minimize freeze-thaw cycles

For storage:

  • Store lyophilized powder at -20°C/-80°C (shelf life approximately 12 months)

  • Store reconstituted protein at -20°C/-80°C (shelf life approximately 6 months)

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as these significantly reduce protein stability and activity

It's advisable to validate protein integrity after reconstitution using methods such as SDS-PAGE or activity assays specific to the research application .

How can researchers verify the purity and integrity of JTY_2660 preparations?

Verification of JTY_2660 purity and integrity is essential before conducting experiments. Standard methods include:

  • SDS-PAGE analysis: Commercial preparations typically achieve >85-90% purity as determined by SDS-PAGE. Researchers should confirm this by running their own gel to visualize a predominant band at approximately 12-15 kDa (the expected size of JTY_2660 plus the His-tag).

  • Western blotting: Using anti-His antibodies to detect the His-tagged protein can confirm the presence of the full-length protein.

  • Mass spectrometry: For more detailed analysis, mass spectrometry can verify the exact molecular weight and confirm the protein identity.

  • Circular dichroism: This technique can provide information about the secondary structure of the protein, which is particularly relevant for membrane proteins that may misfold when not in their native environment.

  • Limited proteolysis: This can assess whether the protein is properly folded, as misfolded proteins often show altered proteolytic patterns.

For membrane proteins like JTY_2660, additional considerations include assessing the protein's behavior in detergent micelles or lipid environments, which may be more representative of its native state .

What expression systems are used for producing recombinant JTY_2660?

Recombinant JTY_2660 can be produced in different expression systems, each with advantages and limitations:

Expression optimization typically involves testing different:

  • Induction conditions (temperature, inducer concentration, duration)

  • Host strains (particularly those optimized for membrane protein expression)

  • Fusion tags (His-tag position and linker composition)

  • Media formulations and additives

The choice of expression system should align with the intended research application and the specific requirements for protein folding and modifications .

How can JTY_2660 be integrated into antimycobacterial screening workflows?

JTY_2660 can be strategically incorporated into antimycobacterial screening workflows by leveraging reporter systems and biochemical assays. One sophisticated approach involves using dual-reporter systems in recombinant M. bovis BCG strains. This method utilizes two reporter genes (such as firefly and Renilla luciferase) under different promoter controls – one constitutive and one pathway-specific. This dual-reporter approach enables simultaneous screening for both broad antimycobacterial activity and pathway-specific inhibition.

For JTY_2660-specific applications, researchers could:

  • Develop assays that monitor JTY_2660 expression or stability in response to compound treatment

  • Create fusion constructs between JTY_2660 and reporter proteins to monitor localization or interactions

  • Design competitive binding assays to identify compounds that interact directly with JTY_2660

The dual-luciferase reporter system described in the literature for M. bovis BCG provides a particularly valuable platform as it allows high-throughput screening capabilities while still providing mechanistic insights. When the firefly luciferase activity decreases, it indicates general growth inhibition, while changes in Renilla luciferase activity can reveal pathway-specific effects. Such systems could be adapted to study JTY_2660 by placing its expression under the control of relevant promoters or by measuring its interaction with other proteins in the presence of potential inhibitors .

What techniques are most effective for structural characterization of JTY_2660?

Structural characterization of membrane proteins like JTY_2660 presents significant challenges but can yield invaluable insights. The most effective techniques include:

  • X-ray crystallography: Requires obtaining well-diffracting crystals, which is challenging for membrane proteins. Success typically depends on:

    • Protein engineering to improve crystallizability (e.g., removal of flexible regions)

    • Selection of appropriate detergents or lipidic cubic phase methods

    • Addition of stabilizing antibody fragments or other binding partners

  • Cryo-electron microscopy (cryo-EM): Increasingly powerful for membrane protein structures, especially when incorporated into nanodiscs or other membrane mimetics.

  • Nuclear magnetic resonance (NMR) spectroscopy: Suitable for smaller membrane proteins or domains, providing dynamic information as well as structure.

  • Computational approaches:

    • Homology modeling based on related UPF0060 family proteins

    • Molecular dynamics simulations to predict membrane interactions

    • AlphaFold2 or similar AI-based structure prediction

  • Hybrid approaches combining low-resolution experimental data with computational modeling.

For JTY_2660 specifically, its relatively small size (110 amino acids) makes it potentially amenable to solution NMR studies if it can be stabilized in suitable membrane mimetics. Alternatively, incorporation into nanodiscs followed by cryo-EM analysis might provide structural insights with less demanding sample preparation than crystallography .

What is known about JTY_2660's potential role in mycobacterial pathogenesis?

While direct evidence linking JTY_2660 to pathogenesis remains limited, several lines of reasoning suggest potential roles:

  • Membrane localization: As a membrane protein, JTY_2660 may participate in host-pathogen interactions, environmental sensing, or maintenance of membrane integrity under stress conditions.

  • Conservation: If JTY_2660 is conserved across pathogenic mycobacterial species, this would suggest functional importance.

  • Expression patterns: Analysis of when and where JTY_2660 is expressed during infection could provide clues to its role. Upregulation during specific phases of infection would suggest involvement in pathogenesis.

  • Structural features: The amino acid sequence suggests multiple transmembrane domains, which could indicate roles in:

    • Transport of nutrients or virulence factors

    • Sensing environmental cues or host defense mechanisms

    • Maintaining membrane integrity during infection

  • Interaction partners: Identifying proteins that interact with JTY_2660 could reveal its role in virulence networks.

Research approaches to investigate pathogenesis connections might include:

  • Gene knockout or knockdown studies to assess virulence in cellular or animal models

  • Expression analysis during different phases of infection

  • Protein-protein interaction studies to identify binding partners

  • Localization studies during infection using fluorescent tags or immunolocalization

These investigations would significantly advance our understanding of JTY_2660's biological role and potentially identify new targets for therapeutic intervention .

How can reporter systems be optimized to study JTY_2660 regulation and function?

Reporter systems offer powerful tools for studying JTY_2660 regulation and function through various sophisticated approaches:

Optimization considerations include:

  • Careful selection of linkers between JTY_2660 and reporter proteins to maintain function

  • Validation that reporter fusions maintain proper localization and don't disrupt function

  • Selection of appropriate reporters based on sensitivity, dynamic range, and compatibility with experimental conditions

  • Design of controls to distinguish specific effects from general stress responses

These reporter approaches can be particularly valuable when studying membrane proteins like JTY_2660, where direct biochemical analysis may be challenging .

What protein-protein interactions might JTY_2660 participate in?

JTY_2660's function likely depends on interactions with other proteins within the mycobacterial membrane environment. Potential interaction partners and investigation methods include:

  • Predicted interaction types:

    • Other membrane proteins in functional complexes

    • Proteins involved in cell wall synthesis or maintenance

    • Signaling proteins that might dock to the cytoplasmic domains

    • Transport-associated proteins if JTY_2660 participates in membrane transport

  • Investigation methods:

    • Co-immunoprecipitation with tagged JTY_2660 followed by mass spectrometry

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Proximity labeling approaches (BioID, APEX) to identify proteins in the vicinity

    • Cross-linking mass spectrometry to capture transient interactions

    • Surface plasmon resonance or microscale thermophoresis for validating specific interactions

  • Bioinformatic prediction approaches:

    • Analyzing gene neighborhood and operonic structure

    • Examining phylogenetic co-occurrence patterns

    • Structural docking predictions between JTY_2660 and potential partners

  • Functional validation of interactions:

    • Genetic knockout of interaction partners to assess phenotypic consequences

    • Mutational analysis of predicted interaction interfaces

    • Functional complementation assays

Understanding these interactions would provide significant insights into JTY_2660's biological role and potential as a drug target. Interaction mapping could reveal whether JTY_2660 functions as part of larger protein complexes or primarily through interactions with membrane lipids or small molecules .

What are the critical considerations when working with membrane proteins like JTY_2660?

Working with membrane proteins like JTY_2660 requires special methodological considerations to maintain native structure and function:

  • Solubilization strategies:

    • Selection of appropriate detergents (mild non-ionic detergents like DDM or LMNG often work well)

    • Detergent concentration optimization to prevent aggregation or denaturation

    • Alternative solubilization approaches like styrene-maleic acid copolymer (SMA) lipid particles

    • Nanodiscs or liposome reconstitution for functional studies

  • Buffer optimization:

    • pH conditions that maintain stability (typically pH 7.0-8.0 for mycobacterial proteins)

    • Ionic strength considerations (150-300 mM NaCl typical starting point)

    • Addition of stabilizing agents (glycerol, specific lipids, cholesterol)

    • Testing different buffering agents (Tris, HEPES, phosphate)

  • Experimental design adaptations:

    • Temperature sensitivity (membrane proteins often more stable at lower temperatures)

    • Longer equilibration times for binding and interaction studies

    • Control experiments with appropriate membrane protein controls

    • Careful interpretation of results in the context of the membrane environment

  • Analytical considerations:

    • Modified protocols for SDS-PAGE (sample heating conditions, loading buffers)

    • Specialized mass spectrometry approaches for membrane proteins

    • Careful design of constructs for structural biology applications

These considerations should be systematically addressed when designing experiments involving JTY_2660, with preliminary optimization studies to establish conditions that maintain the protein in a native-like, functional state .

How can researchers design effective control experiments for JTY_2660 studies?

Designing robust control experiments is critical for rigorous JTY_2660 research:

  • Negative controls:

    • Empty vector or non-expressing cells for background determination

    • Heat-denatured JTY_2660 to distinguish specific from non-specific effects

    • Irrelevant membrane proteins of similar size/properties to control for general membrane effects

    • Buffer-only controls containing all components except JTY_2660

  • Positive controls:

    • Well-characterized membrane proteins from the same family if available

    • Proteins with known interactions or activities to validate assay functionality

    • Tagged versions of JTY_2660 with confirmed activity

  • Validation controls:

    • Multiple detection methods to confirm observations (e.g., both fluorescence and western blotting)

    • Dose-response relationships to establish specificity

    • Competition experiments with unlabeled protein

    • Mutant versions of JTY_2660 with predicted loss of specific functions

  • System-specific controls:

    • For reporter systems: controls for cell viability and general transcription/translation

    • For binding studies: non-specific binding surfaces or proteins

    • For localization studies: markers for specific cellular compartments

    • For antimicrobial testing: established antimycobacterial compounds with known mechanisms

A particularly valuable approach is to design control experiments that can distinguish between effects on JTY_2660 specifically versus general effects on membrane proteins or cellular processes. This typically involves parallel experiments with other membrane proteins that are not expected to share the specific function being investigated .

What special considerations apply to functional assays for membrane proteins like JTY_2660?

Functional assays for membrane proteins present unique challenges and require specialized approaches:

  • Maintaining native environment:

    • Reconstitution into liposomes or nanodiscs to provide a lipid bilayer environment

    • Careful selection of lipid composition to mimic mycobacterial membranes

    • Temperature and pH conditions that reflect physiological conditions for mycobacteria

    • Consideration of membrane potential or pH gradients if relevant to function

  • Transport assays (if JTY_2660 has transport functions):

    • Liposome-based flux assays with encapsulated fluorescent indicators

    • Counterflow assays to measure exchange activities

    • Patch-clamp approaches if ion channel activity is suspected

    • Radiolabeled substrate transport measurements

  • Binding assays:

    • Surface plasmon resonance with careful immobilization strategies

    • Microscale thermophoresis in detergent micelles or nanodiscs

    • Fluorescence-based binding assays with environment-sensitive probes

    • Isothermal titration calorimetry adapted for membrane proteins

  • Structural dynamics:

    • Hydrogen-deuterium exchange mass spectrometry to measure conformational changes

    • Site-directed spin labeling combined with EPR spectroscopy

    • FRET-based approaches to monitor distance changes between domains

  • In-cell functional assays:

    • Growth complementation in knockout strains

    • Reporter systems linked to specific cellular processes

    • Phenotypic assays measuring changes in cell morphology or stress resistance

Validation across multiple assay types is particularly important for membrane proteins, as artifacts related to detergent, lipid composition, or protein orientation can significantly impact results .

How can researchers troubleshoot common issues with JTY_2660 experiments?

Troubleshooting JTY_2660 experiments requires systematic approaches to address common challenges:

  • Poor protein yield or purity:

    • Optimize expression conditions (temperature, induction time, media composition)

    • Test different detergents or solubilization strategies

    • Modify purification protocols (imidazole concentration, wash steps)

    • Consider alternative expression systems or fusion tags

    • Evaluate codon optimization for the expression host

  • Protein aggregation:

    • Perform detergent screening to identify optimal solubilization conditions

    • Add stabilizing agents (glycerol, specific lipids, cholesterol)

    • Reduce protein concentration during handling

    • Explore buffer optimization (pH, salt concentration, additives)

    • Consider size exclusion chromatography to remove aggregates

  • Loss of activity:

    • Minimize freeze-thaw cycles

    • Test activity immediately after purification

    • Validate proper folding using biophysical methods

    • Consider native purification conditions (avoiding harsh denaturants)

    • Maintain cold chain throughout purification

  • Inconsistent results:

    • Standardize protein quantification methods

    • Establish quality control metrics for each preparation

    • Implement rigorous control experiments

    • Use internal standards for normalization

    • Document detailed protocols with all parameters

  • Technical approaches for verification:

    • Circular dichroism to assess secondary structure

    • Fluorescent size exclusion chromatography to evaluate aggregation state

    • Thermal shift assays to measure stability under different conditions

    • Limited proteolysis to confirm proper folding

Maintaining a systematic troubleshooting log and implementing standardized quality control metrics for each protein preparation can significantly improve experimental reproducibility when working with challenging membrane proteins like JTY_2660 .

What approaches can be used to identify small molecule interactions with JTY_2660?

Identifying small molecule interactions with JTY_2660 requires specialized techniques that account for its membrane protein nature:

  • Biophysical binding assays:

    • Surface plasmon resonance with immobilized JTY_2660

    • Microscale thermophoresis in detergent micelles or nanodiscs

    • Isothermal titration calorimetry for thermodynamic parameters

    • Fluorescence-based thermal shift assays to detect stabilizing compounds

  • Structural approaches:

    • X-ray crystallography with soaked or co-crystallized compounds

    • Cryo-EM to visualize compound binding

    • NMR-based fragment screening (HSQC perturbation)

    • Hydrogen-deuterium exchange mass spectrometry to identify binding regions

  • Functional screening:

    • Competition assays with known ligands if identified

    • Activity modulation assays if functional readouts are available

    • Cellular assays monitoring JTY_2660-dependent phenotypes

    • Reporter systems linked to JTY_2660 function or expression

  • Computational approaches:

    • Molecular docking if structural information is available

    • Pharmacophore modeling based on identified ligands

    • Virtual screening of compound libraries

    • Molecular dynamics simulations to identify potential binding pockets

  • Target validation methods:

    • Resistant mutant generation and characterization

    • Structure-activity relationship studies with compound analogs

    • Photoaffinity labeling to confirm binding sites

    • Cellular thermal shift assays (CETSA) to verify target engagement

The dual-reporter systems described for antimycobacterial screening could be particularly valuable for JTY_2660-focused studies, as they can distinguish between general growth inhibition and pathway-specific effects that might relate to JTY_2660 function .

How can JTY_2660 contribute to understanding mycobacterial membrane biology?

JTY_2660 offers a valuable model system for understanding fundamental aspects of mycobacterial membrane biology through several experimental applications:

  • Membrane organization studies:

    • Localization studies using fluorescently tagged JTY_2660

    • Analysis of membrane microdomain association

    • Investigation of protein-lipid interactions specific to mycobacterial membranes

    • Examination of membrane protein turnover and trafficking

  • Comparative biology approaches:

    • Analysis of JTY_2660 conservation across mycobacterial species

    • Functional comparison with homologs from non-pathogenic mycobacteria

    • Investigation of adaptations specific to pathogenic species

    • Evolutionary analysis of UPF0060 family proteins

  • Membrane stress response investigations:

    • Monitoring JTY_2660 expression under various stress conditions

    • Assessing changes in localization or interactions during stress

    • Evaluating phenotypic consequences of JTY_2660 depletion under stress

    • Identifying stress-induced post-translational modifications

  • Membrane biogenesis insights:

    • Tracking JTY_2660 during cell division and membrane extension

    • Examining interactions with cell wall synthesis machinery

    • Investigating potential roles in maintaining membrane asymmetry

    • Studying incorporation into newly synthesized membrane regions

These studies could employ advanced techniques such as:

  • Super-resolution microscopy to visualize membrane organization

  • Lipidomics to detect JTY_2660-dependent changes in membrane composition

  • Crosslinking mass spectrometry to map the membrane protein interactome

  • Cryo-electron tomography to examine membrane ultrastructure

By serving as a specific probe for mycobacterial membranes, JTY_2660 studies can provide insights into the unique properties that distinguish these membranes from those of other bacteria, potentially revealing new targets for antimycobacterial intervention .

What role can JTY_2660 play in developing new antimycobacterial screening platforms?

JTY_2660 can serve as a key component in innovative antimycobacterial screening platforms:

  • Target-based screening approaches:

    • Direct binding assays to identify compounds interacting with JTY_2660

    • Functional assays if specific activities can be established

    • Displacement assays with known ligands or lipids

    • Fragment-based screening to identify chemical starting points

  • Pathway-based reporter systems:

    • Integration into dual-reporter systems similar to the described BCG strain

    • Development of JTY_2660 promoter-driven reporters to monitor expression changes

    • Creation of reporter systems that detect JTY_2660 mislocalization or degradation

    • Biosensors that report on JTY_2660-dependent cellular processes

  • Phenotypic screening enhancements:

    • JTY_2660 knockout or knockdown strains for differential screening

    • Strains with modified JTY_2660 expression to identify sensitizing conditions

    • Conditional expression systems to validate JTY_2660 as the target of hits

    • Fluorescent tagging to monitor effects on localization or stability

  • High-throughput adaptation strategies:

    • Miniaturization to 384- or 1536-well formats

    • Development of homogeneous assay formats (no-wash detection)

    • Adaptation for automated liquid handling and analysis

    • Creation of image-based high-content screening approaches

The dual-luciferase reporter system described for M. bovis BCG provides a particularly promising platform that could be adapted to incorporate JTY_2660-specific readouts. This system allows simultaneous assessment of general growth inhibition through one reporter while using a second reporter to monitor pathway-specific effects, potentially including those involving JTY_2660 .

How can researchers incorporate JTY_2660 into structural biology studies of mycobacterial membrane proteins?

JTY_2660 presents both challenges and opportunities for structural biology studies of mycobacterial membrane proteins:

  • Structure determination approaches:

    • X-ray crystallography with specialized crystallization techniques:

      • Lipidic cubic phase crystallization

      • Detergent screening for optimal solubilization

      • Addition of antibody fragments to create crystal contacts

    • Cryo-EM studies:

      • Incorporation into nanodiscs or amphipols

      • Use of Fab fragments to increase particle size

      • Application of image processing algorithms for small membrane proteins

    • NMR spectroscopy:

      • Solution NMR with detergent-solubilized protein

      • Solid-state NMR in lipid bilayers

      • Selective isotope labeling to focus on specific regions

  • Sample preparation strategies:

    • Construct optimization:

      • Removal of flexible regions

      • Introduction of thermostabilizing mutations

      • Fusion to crystallization chaperones

    • Expression optimization:

      • Testing specialized expression systems for membrane proteins

      • Codon optimization for high-level expression

      • Co-expression with chaperones or binding partners

    • Purification approaches:

      • Tandem affinity purification for highest purity

      • Size exclusion chromatography to ensure monodispersity

      • On-column detergent exchange protocols

  • Methodological innovations:

    • Combining computational prediction with experimental validation

    • Hybrid methods integrating low-resolution experimental data with modeling

    • Serial crystallography at X-ray free-electron lasers for small crystals

    • Integrative structural biology approaches combining multiple techniques

Given JTY_2660's relatively small size (110 amino acids), it may be an excellent candidate for solution NMR studies if it can be maintained in a stable, monodisperse state in detergent micelles or nanodiscs. Additionally, its modest size makes it potentially amenable to computational structure prediction methods like AlphaFold2, which have shown increasing accuracy for membrane proteins .

What insights can comparative analysis of JTY_2660 across mycobacterial species provide?

Comparative analysis of JTY_2660 across mycobacterial species can yield valuable insights into evolution, function, and potential as a drug target:

  • Evolutionary insights:

    • Sequence conservation patterns across pathogenic and non-pathogenic mycobacteria

    • Identification of highly conserved residues suggesting functional importance

    • Detection of positive selection signatures that might indicate host adaptation

    • Phylogenetic analysis to trace the evolution of JTY_2660 within the Mycobacterium genus

  • Structural comparative analysis:

    • Prediction of structural conservation versus variability

    • Identification of species-specific insertions or deletions

    • Analysis of conservation in predicted functional domains or motifs

    • Comparison of predicted transmembrane topology across species

  • Functional implications:

    • Correlation of sequence variations with phenotypic differences between species

    • Assessment of expression pattern conservation across species

    • Investigation of potential co-evolution with interacting partners

    • Comparison of regulation mechanisms between species

  • Experimental approaches:

    • Cross-species complementation studies to test functional conservation

    • Domain swapping between homologs to identify species-specific functional regions

    • Comparative resistance profiles to antimicrobial compounds

    • Systematic mutagenesis guided by comparative sequence analysis

A particularly valuable approach would be to compare JTY_2660 between M. bovis, M. tuberculosis, and non-pathogenic mycobacteria like M. smegmatis to identify features that might be specifically relevant to pathogenesis. Additionally, comparing the genomic context and operonic structure across species could provide clues to functional associations and biological pathways involving JTY_2660 .

How can JTY_2660 be utilized in genetic manipulation studies of mycobacteria?

JTY_2660 offers several applications in genetic manipulation studies of mycobacteria:

  • Gene knockout/knockdown approaches:

    • CRISPR-Cas9 based deletion or disruption of JTY_2660

    • Antisense RNA or CRISPRi for conditional depletion

    • Unmarked deletion using specialized mycobacterial recombineering systems

    • Transposon mutagenesis to assess essentiality under various conditions

  • Gene overexpression systems:

    • Inducible promoters (tetracycline-responsive, acetamide-inducible)

    • Constitutive expression with varying promoter strengths

    • Episomal versus integrative expression constructs

    • Fusion to degradation tags for controlled protein levels

  • Reporter fusion applications:

    • Transcriptional fusions to study promoter activity and regulation

    • Translational fusions to monitor protein levels and localization

    • Split protein complementation to study protein-protein interactions

    • FRET-based approaches to examine conformational changes

  • Advanced genetic manipulation strategies:

    • Site-directed mutagenesis to identify critical residues

    • Domain swapping with homologs to determine functional regions

    • Introduction of regulated degradation domains for temporal control

    • Recombineering approaches for subtle chromosomal modifications

  • Genome editing considerations specific to mycobacteria:

    • Optimization for low transformation efficiency

    • Strategies to overcome mycobacterial DNA restriction systems

    • Specialized selection markers and counterselection systems

    • Methods for confirming genetic modifications in slow-growing species

The dual reporter system described in the literature for M. bovis BCG represents a sophisticated genetic manipulation approach that could be adapted to study JTY_2660 function or regulation. By combining constitutive and inducible reporters, researchers can monitor both general cellular effects and specific responses related to JTY_2660 pathways .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.