Recombinant Mycobacterium bovis UPF0353 protein BCG_1543 (BCG_1543)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a particular tag type, please specify this in your order; we will prioritize fulfilling your request.
Synonyms
BCG_1543; UPF0353 protein BCG_1543
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Target Names
BCG_1543
Target Protein Sequence
MTLPLLGPMTLSGFAHSWFFLFLFVVAGLVALYILMQLARQRRMLRFANMELLESVAPKR PSRWRHVPAILLVLSLLLFTIAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATDVEPSRMV AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKNALDKLQFADRTATGEAI FTALQAIATVGAVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPIS TISFGTPYGFVEIDDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELRAVYSSLQQQIGY ETIKGDASVGWLRLGALALALAALAALLINRRLPT
Uniprot No.

Target Background

Database Links

KEGG: mbb:BCG_1543

Protein Families
UPF0353 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the UPF0353 protein BCG_1543 and what is its biological significance?

The UPF0353 protein BCG_1543 is a protein encoded by the BCG_1543 gene in Mycobacterium bovis, specifically identified in the BCG Pasteur 1173P2 strain. The "UPF" designation (Uncharacterized Protein Family) indicates this is a protein with limited functional characterization, making it an important target for fundamental research . The protein consists of 335 amino acids with a full sequence that suggests it may be a membrane-associated protein based on its hydrophobic regions. The amino acid sequence begins with "MTLPLLGPMTLSGFAHSWFFLFLF" and contains multiple transmembrane helical domains, suggesting potential roles in cell membrane processes or signaling .

The biological significance of BCG_1543 likely relates to Mycobacterium bovis survival mechanisms, potentially contributing to pathogenesis or environmental adaptation. While specific functions remain under investigation, structural analysis suggests membrane localization, indicating possible roles in transport, signaling, or cell wall integrity. Further research on this protein may provide insights into mycobacterial pathogenesis and potential targets for therapeutic intervention.

How does the structure of BCG_1543 relate to potential functions?

Based on sequence analysis, the BCG_1543 protein exhibits structural characteristics that suggest membrane association and potential transmembrane functions. The amino acid sequence reveals hydrophobic regions consistent with membrane spanning domains, particularly in segments containing leucine-rich repeats . The protein appears to contain multiple transmembrane helices, suggesting it may function as:

  • A membrane transporter or channel

  • A signaling receptor

  • A structural component of the mycobacterial cell envelope

Specific structural motifs identified in the sequence include:

Motif TypePositionPotential Function
Transmembrane helixN-terminal regionMembrane anchoring
Leucine-rich regionsMultiple locationsProtein-protein interactions
Hydrophobic domainsThroughout sequenceMembrane integration
C-terminal cytoplasmic domainC-terminusPotential signaling or enzymatic activity

The UniProt entry A1KIS1 associates this protein with the BCG_1543 gene locus, providing a reference point for researchers investigating protein structure-function relationships . While crystallographic data is not yet available in the search results, computational modeling suggests a multi-pass membrane protein topology with potential binding domains for interaction partners.

What experimental systems are appropriate for studying BCG_1543 function?

Several experimental systems are suitable for investigating BCG_1543 function, each with specific advantages depending on research objectives:

Bacterial Expression Systems: E. coli-based expression systems provide high protein yields but may require optimization for proper folding of this mycobacterial membrane protein. Codon optimization may be necessary to account for differences between E. coli and mycobacterial codon usage patterns .

Mycobacterial Models: Native or closely related mycobacterial species (M. smegmatis, attenuated M. tuberculosis) offer more physiologically relevant environments for functional studies. These systems maintain the natural membrane composition and potential interaction partners needed for authentic function .

Cell-Free Expression Systems: Useful for initial characterization and protein production, particularly when coupled with artificial membrane systems like liposomes or nanodiscs to study membrane integration.

Mammalian Cell Models: For studying host-pathogen interactions, mammalian macrophage cell lines can be transfected with constructs expressing BCG_1543 to evaluate effects on cellular processes and immune responses.

When designing experimental approaches, researchers should consider using quasi-experimental designs when randomized controlled studies are not feasible, particularly for in vivo investigations . This approach is especially valuable when examining the effects of BCG_1543 manipulation on host responses or bacterial fitness in complex systems where complete experimental control is challenging.

How can BCG_1543 be utilized in mycobacterial pathogenesis research?

Recombinant BCG_1543 protein offers multiple applications in mycobacterial pathogenesis research, particularly for investigating host-pathogen interactions. As a membrane-associated protein, BCG_1543 may play roles in bacterial survival within host cells or modulation of host immune responses . Several research approaches can be implemented:

Protein-Protein Interaction Studies: Using purified recombinant BCG_1543 as bait in pull-down assays or yeast two-hybrid systems to identify host or bacterial interaction partners. This approach can reveal signaling pathways or cellular processes affected by the protein during infection.

Immunomodulation Assessment: Evaluating how BCG_1543 affects host immune cell functions, including:

  • Cytokine production in macrophages and dendritic cells

  • Phagosomal maturation processes

  • Pattern recognition receptor signaling

  • Antigen presentation pathways

Genetic Manipulation Approaches: Creating knockout or overexpression strains to evaluate the contribution of BCG_1543 to:

  • Bacterial survival in macrophages

  • Resistance to host defense mechanisms

  • Virulence in animal models

  • Growth in varying environmental conditions

When analyzing contradictory results across different experimental systems, researchers should consider context-specific variables like bacterial strain differences, host cell types, and experimental conditions . Careful documentation of these variables helps resolve apparent contradictions in the literature.

What methodologies are effective for studying BCG_1543 in vaccine development research?

BCG_1543 may represent a potential target for novel TB vaccine development strategies, requiring specialized methodological approaches:

Antigen Presentation Analysis: Researchers can employ the recombinant protein to assess MHC presentation and T-cell recognition using:

  • In vitro antigen presentation assays with dendritic cells

  • T-cell stimulation assays measuring proliferation and cytokine production

  • Epitope mapping to identify immunodominant regions

Adjuvant Formulation Studies: The recombinant protein can be incorporated into various adjuvant systems to evaluate:

Adjuvant TypeAssessment ParametersAnalytical Methods
Aluminum saltsAntibody titers, T-cell responsesELISA, ELISpot, flow cytometry
Oil-in-water emulsionsTh1/Th2 balance, memory formationCytokine profiling, memory marker analysis
TLR agonistsInnate immune activation, DC maturationNF-κB reporter assays, DC phenotyping
Liposomal deliveryTargeting efficiency, biodistributionFluorescent tracking, tissue analysis

Recombinant BCG Development: The protein can be overexpressed in BCG strains to potentially enhance immunogenicity:

  • Construction of expression vectors with strong mycobacterial promoters

  • Evaluation of protein localization in recombinant strains

  • Assessment of immune responses to modified strains

  • Protection studies in appropriate animal models

These methodologies should employ quasi-experimental design principles when randomized controlled approaches are not feasible, carefully accounting for variables that might influence outcomes . Multi-disciplinary team approaches, incorporating immunologists, molecular biologists, and bioinformaticians, will likely yield the most comprehensive insights .

How can researchers analyze contradictions in experimental data involving BCG_1543?

Contradictory experimental results involving BCG_1543 require systematic analysis using context-based approaches. Researchers can apply the following methodology:

Contextual Analysis Framework:

  • Identify specific experimental variables that differ between contradictory studies

  • Evaluate species differences and strain variations

  • Assess temporal context variations

  • Examine environmental and experimental conditions

  • Consider methodological differences in protein preparation

When analyzing contradictory findings, researchers should explicitly document:

  • The specific BCG strain used (Pasteur 1173P2 vs. other variants)

  • Protein preparation methods (tag types, purification approaches)

  • Experimental conditions (temperature, pH, buffer composition)

  • Detection methods and their sensitivity thresholds

The framework developed for contradiction detection in biomedical literature can be adapted specifically for BCG_1543 research . This approach involves:

  • Extracting claims about BCG_1543 from published studies

  • Normalizing terminology and experimental conditions

  • Identifying potentially contradictory claims

  • Analyzing contextual factors that might explain the contradictions

  • Developing testable hypotheses to resolve apparent contradictions

Researchers should create detailed documentation of experimental conditions following team science principles, including team charters that clearly define roles and responsibilities in complex multi-disciplinary projects .

What are the optimal conditions for working with recombinant BCG_1543 protein?

The recombinant BCG_1543 protein requires specific handling and storage conditions to maintain structural integrity and biological activity. Based on protein characteristics, the following protocols are recommended:

Storage Conditions:

  • Store stock solution at -20°C for routine use, or -80°C for extended storage

  • Maintain in Tris-based buffer with 50% glycerol to prevent freeze-thaw damage

  • Avoid repeated freeze-thaw cycles; prepare single-use aliquots

  • Working aliquots can be stored at 4°C for up to one week

Buffer Optimization:
The optimal buffer composition depends on the specific application but generally includes:

Buffer ComponentConcentration RangePurpose
Tris-HCl20-50 mM, pH 7.5-8.0pH stabilization
NaCl150-300 mMIonic strength maintenance
Glycerol5-10% for working solutionsProtein stabilization
DTT or β-mercaptoethanol1-5 mMPreventing oxidation of cysteines
Protease inhibitorsManufacturer recommendedPreventing degradation

Experimental Working Conditions:

  • Perform experiments at 25-37°C depending on the assay

  • For membrane-association studies, consider inclusion of mild detergents (0.01-0.05% DDM or CHAPS)

  • When designing binding assays, incorporate 0.05-0.1% BSA to prevent non-specific interactions

  • For ELISA applications, optimize coating conditions (typically 1-5 μg/ml in carbonate buffer, pH 9.6)

These recommendations are derived from general principles for handling recombinant proteins with membrane-association properties, adapted specifically for the BCG_1543 protein characteristics .

How should researchers design quasi-experimental studies to evaluate BCG_1543 function?

When randomized controlled trials are not feasible for studying BCG_1543 function, quasi-experimental designs offer robust alternatives. Researchers should implement the following methodological framework:

Study Design Selection:
Based on research questions and constraints, select from these quasi-experimental approaches:

  • Interrupted Time Series Design: Useful for evaluating BCG_1543 expression changes over time in response to environmental stimuli or drug treatments.

  • Nonequivalent Control Group Design: Appropriate when comparing BCG_1543 function across different mycobacterial strains that cannot be randomly assigned to conditions.

  • Regression Discontinuity Design: Valuable for threshold-based studies examining BCG_1543 activity in relation to specific bacterial density or infection levels .

Internal Validity Enhancement Strategies:

  • Implement multiple baseline measurements before interventions

  • Use matched controls based on relevant bacterial or cellular characteristics

  • Incorporate statistical adjustments for confounding variables

  • Employ blinding procedures during data collection and analysis

  • Conduct sensitivity analyses with varying analytical parameters

Reporting Framework:
Document the following elements explicitly:

  • Rationale for quasi-experimental approach over true experimental design

  • Potential threats to internal validity and mitigation strategies

  • Detailed description of comparison groups and assignment method

  • Statistical approaches for controlling confounding variables

  • Limitations of the selected design

These quasi-experimental approaches are particularly valuable when studying BCG_1543 in complex systems like animal models or when using clinical isolates with inherent variability that precludes randomization.

What are the key considerations for designing protein-protein interaction studies with BCG_1543?

Investigating protein-protein interactions (PPIs) involving BCG_1543 requires careful experimental design to account for its membrane-associated nature and potential conformational requirements. Researchers should consider:

Selection of Appropriate PPI Detection Methods:

MethodAdvantagesTechnical Considerations
Bacterial Two-HybridAllows membrane protein analysis, natural bacterial environmentRequires optimization for mycobacterial proteins, potential false positives
Co-ImmunoprecipitationDetects interactions in near-native conditionsRequires effective antibodies, membrane solubilization optimization
Surface Plasmon ResonanceProvides kinetic and affinity measurementsProper immobilization strategies needed for membrane proteins
Proximity Labeling (BioID)Identifies transient and stable interactions in cellular contextRequires genetic fusion constructs, may alter protein function
Fluorescence Resonance Energy TransferEnables real-time monitoring in living cellsRequires fluorescent protein fusion validation

Critical Experimental Controls:

  • Tag-only controls to eliminate tag-mediated interaction artifacts

  • Negative controls using unrelated membrane proteins of similar size/topology

  • Known interaction partners as positive controls when available

  • Denatured protein controls to verify specificity of structural interactions

  • Competition assays with unlabeled protein to confirm binding specificity

Membrane Environment Considerations:

  • Determine if native lipid environment is essential for interaction

  • Consider reconstitution in liposomes or nanodiscs for maintaining membrane context

  • Evaluate detergent effects on protein conformation and interaction capability

  • Test multiple solubilization conditions to optimize interaction detection

When analyzing contradictory interaction data across different experimental systems, researchers should systematically document experimental conditions following the context analysis framework . This approach helps identify whether contradictions represent true biological variability or result from methodological differences.

How should researchers analyze ELISA data using recombinant BCG_1543?

ELISA assays utilizing recombinant BCG_1543 protein require specific analytical approaches to ensure accurate and reproducible results. The following methodological framework is recommended:

Standard Curve Optimization:

  • Prepare serial dilutions of recombinant BCG_1543 (typically 0.1-10 μg/ml)

  • Use four-parameter logistic regression (4PL) for standard curve fitting

  • Ensure R² value exceeds 0.98 for reliable quantification

  • Validate the linear range where coefficient of variation remains below 15%

Data Normalization Strategies:

Normalization MethodApplication ScenarioImplementation
Blank subtractionAll ELISA protocolsSubtract mean OD of buffer-only wells from all readings
Percent of controlComparative studiesExpress values as percentage of positive control samples
Z-score transformationHigh-throughput screening(Sample value - Mean)/Standard deviation
Log transformationWide concentration rangesApply log10 transformation to linearize response

Statistical Analysis Framework:

  • Assess normality of data distribution using Shapiro-Wilk or Kolmogorov-Smirnov tests

  • For normally distributed data, apply parametric tests (t-test, ANOVA)

  • For non-normal distributions, use non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis)

  • Calculate confidence intervals (typically 95%) for all measurements

  • Implement multiple comparison corrections for experiments with numerous conditions

Addressing Potential Artifacts:

  • Evaluate hook effect at high concentrations

  • Identify and manage matrix effects through dilution series analysis

  • Implement heteroscedasticity correction when variance changes across concentration range

  • Document lot-to-lot variability of recombinant protein standards

These analytical approaches ensure robust interpretation of ELISA data involving BCG_1543 protein . When reconciling contradictory ELISA results across studies, researchers should apply context analysis to identify methodological differences that might explain discrepancies .

How can researchers effectively manage contradictions in published data about BCG_1543?

Managing contradictions in published BCG_1543 research requires systematic approaches that extend beyond simple literature review. Researchers should implement:

Contradiction Classification System:

  • Apparent contradictions: Conflicting claims that can be resolved through careful context analysis

  • Methodological contradictions: Discrepancies arising from different experimental approaches

  • Biological contradictions: True biological variability due to strain differences or conditions

  • Interpretive contradictions: Differences in how similar data are interpreted

For each contradiction identified, researchers should apply a structured analysis approach:

  • Extract precise claims from relevant publications about BCG_1543

  • Normalize terminology and standardize experimental conditions for comparison

  • Categorize claims based on experimental context, including species, strain, and environmental factors

  • Identify underspecified contexts that might explain apparent contradictions

  • Generate testable hypotheses to resolve contradictions through targeted experiments

Contradiction Resolution Strategies:

Contradiction TypeResolution ApproachDocumentation Method
Context-dependentSpecify conditions where each finding appliesCondition-result mapping table
MethodologicalDirect comparison using standardized protocolsHead-to-head validation studies
Strain-specificCross-strain validation experimentsPhylogenetic correlation analysis
Temporal variationTime-course studies under controlled conditionsTime-series visualization

When designing experiments to resolve contradictions, quasi-experimental approaches may be necessary when full experimental control is not possible . These designs should explicitly account for potential confounding variables that may explain contradictory findings.

What team-based approaches optimize research outcomes when studying BCG_1543?

Complex research involving BCG_1543 benefits from structured team science approaches that enhance collaboration and research quality. Researchers should implement:

Team Charter Development:
Create a formal team charter document that defines:

  • The team's purpose and specific research objectives related to BCG_1543

  • Clear roles and responsibilities of team members based on expertise

  • Decision-making processes and conflict resolution procedures

  • Communication protocols and meeting schedules

  • Data sharing agreements and publication authorship criteria

Interdisciplinary Team Composition:
Assemble teams with complementary expertise including:

  • Mycobacterial geneticists for strain development and manipulation

  • Structural biologists for protein characterization

  • Immunologists for host-response studies

  • Bioinformaticians for sequence analysis and modeling

  • Statisticians for complex data analysis

Collaborative Data Analysis Framework:

PhaseTeam ApproachTools and Methods
Study DesignCollaborative protocol developmentProtocol pre-registration, power analysis
Data CollectionStandardized procedures with cross-validationElectronic lab notebooks, standardized forms
Data IntegrationRegular data review meetingsCloud-based data repositories, version control
AnalysisComplementary analytical approachesTransparent computational workflows, code sharing
InterpretationStructured consensus processMultiple-perspective analysis, devil's advocate roles

Managing Contradictory Findings:
When team members generate contradictory results:

  • Document exact experimental conditions using standardized templates

  • Conduct side-by-side replications with team member cross-training

  • Implement blinded analysis by team members not involved in data generation

  • Develop consensus interpretation that accounts for methodological differences

  • Design follow-up experiments specifically targeting variables that might explain contradictions

This structured team science approach is particularly valuable for resolving complex questions about BCG_1543 function, where interdisciplinary perspectives and methodological diversity enhance research outcomes.

What quality control measures should be implemented when working with recombinant BCG_1543?

Ensuring consistent protein quality is essential for reproducible research with recombinant BCG_1543. Researchers should implement a comprehensive quality control regimen:

Initial Protein Characterization:

ParameterAssessment MethodAcceptance Criteria
PuritySDS-PAGE with Coomassie staining>90% single band at expected molecular weight
Identity confirmationWestern blot with tag-specific antibodySingle band at expected molecular weight
Mass verificationMass spectrometry (MALDI-TOF or ESI-MS)Mass within 0.1% of theoretical prediction
Endotoxin levelsLAL assay<0.1 EU/μg protein for cell-based assays
Aggregation stateSize exclusion chromatography>80% monodisperse peak

Functional Validation:

  • Develop application-specific activity assays based on predicted function

  • For membrane proteins, verify proper folding using circular dichroism

  • Assess binding to known or predicted interaction partners

  • Evaluate stability under experimental conditions using thermal shift assays

Storage Stability Monitoring:

  • Implement accelerated stability testing at elevated temperatures

  • Verify activity retention after defined storage periods

  • Document lot-to-lot consistency through comparative analysis

  • Maintain reference standards from validated lots for long-term comparisons

Documentation Requirements:

  • Detailed batch production records

  • Results of all quality control tests with pass/fail criteria

  • Storage conditions and freeze-thaw cycle tracking

  • Expiration date determination based on stability data

Implementing these quality control measures ensures experimental reproducibility and facilitates accurate interpretation of results, particularly when analyzing potentially contradictory findings across different studies or experimental conditions .

How can researchers troubleshoot common experimental challenges with BCG_1543?

Working with membrane-associated proteins like BCG_1543 presents specific challenges that require systematic troubleshooting approaches:

Poor Protein Solubility:

ProblemTroubleshooting ApproachImplementation Strategy
Aggregation during purificationScreen detergent panelTest 8-10 detergents at varying concentrations
Precipitation after buffer exchangeOptimize buffer componentsAdjust ionic strength, add stabilizing agents
Loss during filtrationEvaluate membrane bindingUse low protein-binding filters, pre-saturate membranes
Temperature sensitivityEstablish thermal stability profileDetermine temperature range for maintaining solubility

Inconsistent ELISA Results:

  • Optimize coating conditions (buffer, concentration, time, temperature)

  • Evaluate blocking efficiency with different blocking agents

  • Test multiple antibody dilutions in a grid format

  • Assess plate type effects (standard vs. high-binding)

  • Implement more stringent washing procedures

Functional Activity Loss:

  • Determine if activity correlates with specific buffer components

  • Evaluate effect of freeze-thaw cycles on activity metrics

  • Test addition of stabilizing agents (glycerol, sucrose, BSA)

  • Consider reconstitution in lipid environments for membrane proteins

  • Examine time-dependent activity loss under working conditions

Reproducibility Issues Across Experiments:

  • Implement detailed documentation of experimental conditions

  • Standardize protein handling protocols across team members

  • Create reference standards for comparison across experiments

  • Consider environmental factors (temperature fluctuations, light exposure)

  • Validate critical reagents from multiple suppliers

When contradictory results persist despite troubleshooting, researchers should consider applying context analysis frameworks to identify specific variables that might explain discrepancies, following structured approaches for analyzing contradictions in experimental data .

What are the key considerations for experimental design validation when studying BCG_1543?

Validating experimental designs for BCG_1543 research requires systematic assessment of multiple factors to ensure robust and reproducible outcomes:

Statistical Power and Sample Size Determination:

  • Conduct a priori power analysis based on expected effect sizes

  • Calculate minimum sample sizes needed for detecting biologically meaningful differences

  • Consider clustered or repeated measures designs to increase statistical efficiency

  • Implement sequential analysis approaches for resource-intensive experiments

Control Implementation Strategy:

Control TypePurposeImplementation
Vehicle controlsAccount for buffer/solvent effectsMatch all components except BCG_1543
Tag-only controlsDistinguish protein vs. tag effectsExpress and purify tag alone
Biological negative controlsEstablish baseline responsesUse unrelated proteins of similar size/structure
Positive controlsValidate assay performanceInclude proteins with known activity
Process controlsTrack procedural variablesProcess identical samples through alternate workflows

Blinding and Randomization:

  • Implement sample coding systems to blind analysts to treatment groups

  • Randomize sample processing order to distribute time-dependent variables

  • Consider block randomization to control for batch effects

  • Document randomization schemes for reproducibility and reporting

Validation Across Experimental Models:

  • Test key findings in multiple experimental systems

  • Evaluate consistency across different cell types or animal models

  • Compare in vitro and in vivo results systematically

  • Assess translation between simplified and complex models

When full experimental control is not possible, implement quasi-experimental designs with explicit acknowledgment of their limitations and strategies to mitigate threats to internal validity . For complex studies requiring multidisciplinary expertise, employ team science approaches with clear documentation of roles, responsibilities, and decision-making processes .

Future Research Directions and Emerging Methodologies

The study of Mycobacterium bovis UPF0353 protein BCG_1543 represents an evolving field with several promising research directions. Researchers interested in advancing knowledge about this protein should consider:

Structural Biology Approaches:

  • Cryo-electron microscopy for membrane protein structure determination

  • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Molecular dynamics simulations to predict functional movements and conformational changes

  • Integrative structural biology combining multiple experimental techniques

Functional Genomics Strategies:

  • CRISPR interference approaches in mycobacterial systems

  • Conditional knockdown systems for essential gene analysis

  • Complementation studies with site-directed mutants

  • Transcriptomic profiling under various stress conditions

Translational Research Applications:

  • Evaluation as diagnostic biomarker for mycobacterial infections

  • Assessment as vaccine component or adjuvant target

  • Exploration of strain-specific variations and correlation with virulence

  • Investigation of host immune recognition patterns

These future directions will benefit from the application of quasi-experimental designs when randomized approaches are not feasible , and from systematic approaches to contradiction resolution when conflicting data emerge . Collaborative team science methods will be particularly valuable for integrating diverse experimental approaches and expertise .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.