Recombinant Mycobacterium bovis UPF0353 protein JTY_1518 (JTY_1518)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mycobacterium Bovis UPF0353 Protein JTY_1518

Recombinant Mycobacterium bovis UPF0353 protein JTY_1518 is a protein derived from Mycobacterium bovis, a bacterium that causes tuberculosis in cattle . JTY_1518 is also referred to as UPF0353 protein JTY_1518 . The "recombinant" aspect indicates that this protein is produced using recombinant DNA technology, where the gene encoding JTY_1518 is inserted into a host organism (e.g., E. coli) to facilitate its expression and production .

Key Features

  • Full Length: The recombinant protein consists of the full-length sequence of the native Mycobacterium bovis UPF0353 protein JTY_1518, comprising 335 amino acids .

  • His-Tag: It includes an N-terminal His tag, which is a sequence of histidine residues added to the protein to allow for easy purification using affinity chromatography .

  • Source: Expressed in E. coli .

  • Purity: Greater than 90% as determined by SDS-PAGE .

  • UniProt ID: C1ANC7

Amino Acid Sequence

The amino acid sequence of the recombinant protein is :

MTLPLLGPMTLSGFAHSWFFLFLFVVAGLVALYILMQLARQRRMLRFANMELLESVAPKR
PSRWRHVPAILLVLSLLLFTIAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATDVEPSRMV
AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKNALDKLQFADRTATGEAI
FTALQAIATVGAVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPIS
TISFGTPYGFVEIDDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELRAVYSSLQQQIGY
ETIKGDASVGWLRLGALALALAALAALLINRRLPT

Production and Formulation

  • Form: Supplied as a lyophilized powder .

  • Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .

  • Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0 .

  • Reconstitution: Recommended to briefly centrifuge the vial prior to opening. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (final concentration) and aliquoting is recommended for long-term storage at -20℃/-80℃ .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
JTY_1518; UPF0353 protein JTY_1518
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
Target Names
JTY_1518
Target Protein Sequence
MTLPLLGPMTLSGFAHSWFFLFLFVVAGLVALYILMQLARQRRMLRFANMELLESVAPKR PSRWRHVPAILLVLSLLLFTIAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATDVEPSRMV AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKNALDKLQFADRTATGEAI FTALQAIATVGAVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPIS TISFGTPYGFVEIDDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELRAVYSSLQQQIGY ETIKGDASVGWLRLGALALALAALAALLINRRLPT
Uniprot No.

Target Background

Database Links

KEGG: mbt:JTY_1518

Protein Families
UPF0353 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the UPF0353 protein JTY_1518 and what is its role in Mycobacterium bovis?

UPF0353 protein JTY_1518 is a full-length protein (335 amino acids) found in Mycobacterium bovis, the causative agent of bovine tuberculosis. While its exact function remains under investigation, sequence analysis suggests it may serve as a membrane-associated protein based on its hydrophobic regions. The protein contains multiple transmembrane domains and likely plays a role in cell wall integrity or membrane transport processes. Research indicates potential involvement in bacterial survival mechanisms, as it belongs to a family of uncharacterized proteins (UPF) that often serve critical but not yet fully elucidated functions in bacterial physiology . Understanding this protein's function may provide insights into M. bovis pathogenicity and survival within host cells.

What expression systems are suitable for producing recombinant JTY_1518 protein?

Recombinant JTY_1518 protein can be successfully expressed in multiple heterologous systems, each offering distinct advantages depending on research needs. E. coli expression systems are commonly used for high-yield production, particularly for structural studies requiring substantial protein quantities . For studies requiring post-translational modifications, eukaryotic expression systems such as yeast, baculovirus-infected insect cells, or mammalian cells may be more appropriate . When selecting an expression system, researchers should consider:

  • Protein folding requirements

  • Post-translational modification needs

  • Downstream application requirements

  • Scale of production needed

  • Available laboratory resources

For immunological studies, mammalian expression systems may provide protein with more native-like characteristics, while E. coli systems typically offer higher yields at lower cost .

How should recombinant JTY_1518 protein be stored and reconstituted for maximum stability?

Proper storage and reconstitution are critical for maintaining JTY_1518 protein activity. The lyophilized protein powder should be stored at -20°C to -80°C upon receipt. Before opening, briefly centrifuge the vial to bring contents to the bottom. For reconstitution:

  • Add deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended)

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Store long-term aliquots at -20°C/-80°C

Repeated freeze-thaw cycles significantly decrease protein activity and should be avoided. For storage buffer conditions, Tris/PBS-based buffer with 6% trehalose at pH 8.0. has been shown to maintain stability . When designing experiments, it's advisable to perform activity assays after reconstitution to confirm protein functionality.

How can JTY_1518 protein be utilized in studying host-pathogen interactions in bovine tuberculosis?

JTY_1518 protein serves as a valuable tool for investigating host-pathogen interactions in bovine tuberculosis research. Studies utilizing co-culture models of antigen-presenting cells (APCs) and autologous lymphocytes have shown that M. bovis proteins can significantly influence innate immune responses . To effectively use JTY_1518 in such studies:

  • Design experiments comparing wild-type and mutant forms of the protein to assess functional differences

  • Use purified protein in stimulation assays with bovine immune cells to measure cytokine production

  • Employ flow cytometry to evaluate cell surface marker expression (e.g., IL-2R/CD25) on immune cell populations following exposure to JTY_1518

  • Assess changes in gene expression of immune mediators such as iNOS, IL-22, and IFN-γ via RT-qPCR

  • Compare responses across different M. bovis strains with varying virulence to contextualize findings

Research has demonstrated that strain differences in M. bovis significantly impact immune responses, with virulent strains like Mb04-303 inducing stronger pro-inflammatory profiles compared to attenuated strains . JTY_1518 may contribute to these differential responses through strain-specific variations in protein sequence or expression levels.

What methods are recommended for studying potential protein-protein interactions involving JTY_1518?

Investigating protein-protein interactions of JTY_1518 requires robust methodological approaches. Based on research practices with similar mycobacterial proteins, the following techniques are recommended:

  • Bacterial Two-Hybrid System: This approach has been successfully used for mycobacterial proteins, including ESAT-6 variants. For JTY_1518, cloning the gene as a fusion to adenylate cyclase fragments (e.g., in vectors like pKT25 and pUT18C) allows for detection of protein interactions through β-galactosidase activity measurements .

  • Co-immunoprecipitation (Co-IP): Using antibodies against JTY_1518 or its interaction partners to pull down protein complexes from bacterial lysates or from infected host cells.

  • Surface Plasmon Resonance (SPR): For kinetic analysis of JTY_1518 binding to purified candidate interaction partners.

  • Cross-linking Mass Spectrometry: To identify novel binding partners in an unbiased manner.

When analyzing results, it's important to incorporate appropriate controls, including known interacting protein pairs (e.g., using plasmids like T18-Zip and T25-Zip as positive controls) . Quantitative assessment of interaction strength should be performed using established metrics like β-galactosidase activity units in bacterial two-hybrid systems.

How does JTY_1518 expression vary across different M. bovis strains and what are the implications?

JTY_1518 expression patterns can vary significantly across M. bovis strains with differing virulence profiles. Research comparing strains like Mb534 (attenuated), MbNCTC10772 (moderately virulent), and Mb04-303 (highly virulent) has demonstrated that virulence factors often show strain-specific expression patterns that correlate with pathogenicity . To investigate JTY_1518 expression differences:

  • Perform comparative transcriptomics (RNA-Seq) across strains under identical growth conditions

  • Use quantitative proteomics to assess protein abundance differences

  • Develop strain-specific antibodies for Western blot analysis

  • Construct reporter strains with JTY_1518 promoter fusions to quantify expression levels

Expression differences may have significant implications for:

  • Bacterial survival within host cells

  • Modulation of host immune responses

  • Potential as diagnostic biomarkers

  • Vaccine development strategies

When analyzing strain-specific differences, it's crucial to maintain consistent growth conditions and growth phases, as gene expression can vary considerably depending on environmental factors and bacterial growth stage.

What are the optimal experimental conditions for using recombinant JTY_1518 in immunological assays?

When designing immunological assays with recombinant JTY_1518, several parameters must be optimized to ensure reliable and reproducible results:

  • Protein Concentration: Titrate protein concentrations (typically 0.1-10 μg/mL) to determine optimal stimulation conditions for different immune cell types

  • Endotoxin Removal: Ensure protein preparations are endotoxin-free (<0.1 EU/μg) to prevent non-specific immune activation

  • Cell Types: For bovine tuberculosis research, consider using:

    • Peripheral blood mononuclear cells (PBMCs)

    • Differentiated antigen-presenting cells co-cultured with autologous lymphocytes (ratio 1:10)

    • Macrophage cell lines for standardized assays

  • Incubation Time: Optimize based on readout (typically 16-24 hours for cytokine expression)

  • Controls: Include:

    • Non-stimulated cells (negative control)

    • Known immunostimulatory molecules (positive control)

    • Heat-inactivated protein (to distinguish activity from potential contaminants)

For measurement of immune responses, flow cytometry can be used to assess activation markers like CD25 on specific cell populations (e.g., WC1+ and NKp46+ cells), while RT-qPCR can quantify expression of immune mediators such as iNOS, IL-22, and IFN-γ .

How should researchers design experiments to compare wild-type versus mutant forms of JTY_1518?

Comparing wild-type and mutant forms of JTY_1518 requires careful experimental design to accurately assess functional differences. Based on approaches used with other M. bovis proteins, the following methodology is recommended:

  • Construct Generation:

    • PCR amplify wild-type JTY_1518 gene from reference strains

    • Introduce targeted mutations through site-directed mutagenesis

    • Clone both versions into identical expression vectors with the same tags

    • Verify constructs by sequencing to confirm mutations and rule out PCR errors

  • Expression and Purification:

    • Express both proteins under identical conditions

    • Purify using the same protocol (e.g., His-tag affinity chromatography)

    • Verify protein quality by SDS-PAGE and Western blot

    • Confirm similar yield and purity between preparations

  • Functional Comparisons:

    • Perform structural analysis (circular dichroism) to assess folding differences

    • Compare stability under various conditions

    • Assess binding to potential interaction partners

    • Evaluate immunostimulatory properties using standardized cellular assays

  • Data Analysis:

    • Use paired statistical tests for direct comparisons

    • Normalize results to account for batch variation

    • Consider multiple biological replicates (minimum n=5 based on previous studies)

This approach has been successfully used for studying variants of other M. bovis proteins, such as ESAT-6, where a single amino acid change (T63A) significantly affected immunological properties .

What statistical approaches are recommended for analyzing immunological data from JTY_1518 studies?

Immunological studies with JTY_1518 generate complex datasets requiring appropriate statistical analysis. Based on published research with similar M. bovis proteins, the following statistical approaches are recommended:

  • For gene expression data (RT-qPCR):

    • Use reference genes like GAPDH for normalization

    • Apply the pair-wise fixed reallocation randomization test for comparing expression levels between infected and non-infected conditions

    • Calculate relative expression using the 2^(-ΔΔCT) method

    • Present data as mean values with standard error of the mean (SEM)

  • For flow cytometry data:

    • Use non-parametric tests like the Friedman test for comparing multiple conditions

    • Present data as minimum, maximum, and mean values

    • Consider both percentage of positive cells and mean fluorescence intensity

    • Set consistent gating strategies across all samples

  • For bacterial load and functional assays:

    • Use appropriate transformation (log transformation) for non-normally distributed data

    • Apply repeated measures ANOVA when comparing multiple conditions

    • Include at least 5-7 biological replicates based on previous study power calculations

  • For protein-protein interaction studies:

    • Quantify interaction strength using standardized metrics

    • Include appropriate positive and negative controls

    • Apply statistical tests appropriate for the experimental design

When reporting results, clearly state both the statistical test used and the precise p-values obtained, with significance typically set at p<0.05.

How can researchers address contradictory results in JTY_1518 functional studies?

Contradictory results in JTY_1518 functional studies may arise from multiple factors. A systematic approach to reconciling such discrepancies includes:

  • Methodological Variations Assessment:

    • Compare protein preparation methods (expression system, purification approach, tags used)

    • Examine differences in protein concentration, buffer composition, and storage conditions

    • Evaluate experimental conditions (temperature, pH, incubation time)

    • Consider cell types and species differences in experimental models

  • Strain-Specific Effects Analysis:

    • Determine the exact M. bovis strain source of the JTY_1518 protein

    • Compare sequence variations that might affect protein function

    • Consider virulence differences between strains (e.g., Mb534 vs. Mb04-303)

    • Assess potential differences in post-translational modifications

  • Technical Validation:

    • Confirm protein identity and integrity by mass spectrometry

    • Verify activity using multiple independent assays

    • Assess endotoxin contamination that might confound immunological results

    • Examine batch-to-batch variation in protein preparations

  • Biological Context Consideration:

    • Evaluate the presence of co-factors that might affect protein function

    • Consider the influence of other bacterial components in the experimental system

    • Assess host cell activation status prior to experiments

When publishing results, transparently report all experimental conditions and acknowledge limitations of the study design to facilitate interpretation of apparently contradictory findings across studies.

What techniques are most effective for determining the structure-function relationship of JTY_1518?

Understanding the structure-function relationship of JTY_1518 requires a multi-technique approach. Based on structural biology best practices, the following methods are recommended:

A comprehensive approach would begin with computational predictions to guide experimental design, followed by targeted mutagenesis to validate the importance of specific residues or domains in JTY_1518 function within the bacterial cell or during host-pathogen interactions.

How can genome-wide approaches contribute to understanding JTY_1518 function in M. bovis?

Genome-wide approaches offer powerful strategies for elucidating JTY_1518 function within the broader context of M. bovis biology. These approaches include:

  • Comparative Genomics:

    • Analysis of JTY_1518 conservation across mycobacterial species

    • Identification of co-evolved genes that may function in the same pathway

    • Examination of genomic context and operonic structure

    • Correlation of gene presence/absence with phenotypic traits across strains

  • Transcriptomics:

    • RNA-Seq analysis of wild-type versus JTY_1518 knockout strains

    • Identification of genes with correlated expression patterns

    • Determination of expression changes under different environmental conditions

    • Single-cell RNA-Seq to assess expression heterogeneity within bacterial populations

  • Proteomics:

    • Pull-down assays coupled with mass spectrometry to identify interaction partners

    • Quantitative proteomics to assess proteome-wide changes in JTY_1518 mutants

    • Protein turnover analysis to determine JTY_1518 stability under different conditions

    • Post-translational modification mapping

  • Functional Genomics:

    • Transposon mutagenesis screens to identify synthetic lethal interactions

    • CRISPR interference to assess essentiality under various conditions

    • Suppressor screens to identify genetic interactions

These approaches have been successfully applied to other M. bovis proteins and could provide valuable insights into JTY_1518 function, potentially revealing unexpected roles in bacterial physiology or host-pathogen interactions that are not evident from directed studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.