Recombinant Mycobacterium bovis UPF0353 protein JTY_1518 is a protein derived from Mycobacterium bovis, a bacterium that causes tuberculosis in cattle . JTY_1518 is also referred to as UPF0353 protein JTY_1518 . The "recombinant" aspect indicates that this protein is produced using recombinant DNA technology, where the gene encoding JTY_1518 is inserted into a host organism (e.g., E. coli) to facilitate its expression and production .
Full Length: The recombinant protein consists of the full-length sequence of the native Mycobacterium bovis UPF0353 protein JTY_1518, comprising 335 amino acids .
His-Tag: It includes an N-terminal His tag, which is a sequence of histidine residues added to the protein to allow for easy purification using affinity chromatography .
The amino acid sequence of the recombinant protein is :
MTLPLLGPMTLSGFAHSWFFLFLFVVAGLVALYILMQLARQRRMLRFANMELLESVAPKR
PSRWRHVPAILLVLSLLLFTIAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATDVEPSRMV
AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKNALDKLQFADRTATGEAI
FTALQAIATVGAVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPIS
TISFGTPYGFVEIDDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELRAVYSSLQQQIGY
ETIKGDASVGWLRLGALALALAALAALLINRRLPT
Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0 .
Reconstitution: Recommended to briefly centrifuge the vial prior to opening. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (final concentration) and aliquoting is recommended for long-term storage at -20℃/-80℃ .
KEGG: mbt:JTY_1518
UPF0353 protein JTY_1518 is a full-length protein (335 amino acids) found in Mycobacterium bovis, the causative agent of bovine tuberculosis. While its exact function remains under investigation, sequence analysis suggests it may serve as a membrane-associated protein based on its hydrophobic regions. The protein contains multiple transmembrane domains and likely plays a role in cell wall integrity or membrane transport processes. Research indicates potential involvement in bacterial survival mechanisms, as it belongs to a family of uncharacterized proteins (UPF) that often serve critical but not yet fully elucidated functions in bacterial physiology . Understanding this protein's function may provide insights into M. bovis pathogenicity and survival within host cells.
Recombinant JTY_1518 protein can be successfully expressed in multiple heterologous systems, each offering distinct advantages depending on research needs. E. coli expression systems are commonly used for high-yield production, particularly for structural studies requiring substantial protein quantities . For studies requiring post-translational modifications, eukaryotic expression systems such as yeast, baculovirus-infected insect cells, or mammalian cells may be more appropriate . When selecting an expression system, researchers should consider:
Protein folding requirements
Post-translational modification needs
Downstream application requirements
Scale of production needed
Available laboratory resources
For immunological studies, mammalian expression systems may provide protein with more native-like characteristics, while E. coli systems typically offer higher yields at lower cost .
Proper storage and reconstitution are critical for maintaining JTY_1518 protein activity. The lyophilized protein powder should be stored at -20°C to -80°C upon receipt. Before opening, briefly centrifuge the vial to bring contents to the bottom. For reconstitution:
Add deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL
Add glycerol to a final concentration of 5-50% (typically 50% is recommended)
Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles
Store working aliquots at 4°C for up to one week
Repeated freeze-thaw cycles significantly decrease protein activity and should be avoided. For storage buffer conditions, Tris/PBS-based buffer with 6% trehalose at pH 8.0. has been shown to maintain stability . When designing experiments, it's advisable to perform activity assays after reconstitution to confirm protein functionality.
JTY_1518 protein serves as a valuable tool for investigating host-pathogen interactions in bovine tuberculosis research. Studies utilizing co-culture models of antigen-presenting cells (APCs) and autologous lymphocytes have shown that M. bovis proteins can significantly influence innate immune responses . To effectively use JTY_1518 in such studies:
Design experiments comparing wild-type and mutant forms of the protein to assess functional differences
Use purified protein in stimulation assays with bovine immune cells to measure cytokine production
Employ flow cytometry to evaluate cell surface marker expression (e.g., IL-2R/CD25) on immune cell populations following exposure to JTY_1518
Assess changes in gene expression of immune mediators such as iNOS, IL-22, and IFN-γ via RT-qPCR
Compare responses across different M. bovis strains with varying virulence to contextualize findings
Research has demonstrated that strain differences in M. bovis significantly impact immune responses, with virulent strains like Mb04-303 inducing stronger pro-inflammatory profiles compared to attenuated strains . JTY_1518 may contribute to these differential responses through strain-specific variations in protein sequence or expression levels.
Investigating protein-protein interactions of JTY_1518 requires robust methodological approaches. Based on research practices with similar mycobacterial proteins, the following techniques are recommended:
Bacterial Two-Hybrid System: This approach has been successfully used for mycobacterial proteins, including ESAT-6 variants. For JTY_1518, cloning the gene as a fusion to adenylate cyclase fragments (e.g., in vectors like pKT25 and pUT18C) allows for detection of protein interactions through β-galactosidase activity measurements .
Co-immunoprecipitation (Co-IP): Using antibodies against JTY_1518 or its interaction partners to pull down protein complexes from bacterial lysates or from infected host cells.
Surface Plasmon Resonance (SPR): For kinetic analysis of JTY_1518 binding to purified candidate interaction partners.
Cross-linking Mass Spectrometry: To identify novel binding partners in an unbiased manner.
When analyzing results, it's important to incorporate appropriate controls, including known interacting protein pairs (e.g., using plasmids like T18-Zip and T25-Zip as positive controls) . Quantitative assessment of interaction strength should be performed using established metrics like β-galactosidase activity units in bacterial two-hybrid systems.
JTY_1518 expression patterns can vary significantly across M. bovis strains with differing virulence profiles. Research comparing strains like Mb534 (attenuated), MbNCTC10772 (moderately virulent), and Mb04-303 (highly virulent) has demonstrated that virulence factors often show strain-specific expression patterns that correlate with pathogenicity . To investigate JTY_1518 expression differences:
Perform comparative transcriptomics (RNA-Seq) across strains under identical growth conditions
Use quantitative proteomics to assess protein abundance differences
Develop strain-specific antibodies for Western blot analysis
Construct reporter strains with JTY_1518 promoter fusions to quantify expression levels
Expression differences may have significant implications for:
Bacterial survival within host cells
Modulation of host immune responses
Potential as diagnostic biomarkers
Vaccine development strategies
When analyzing strain-specific differences, it's crucial to maintain consistent growth conditions and growth phases, as gene expression can vary considerably depending on environmental factors and bacterial growth stage.
When designing immunological assays with recombinant JTY_1518, several parameters must be optimized to ensure reliable and reproducible results:
Protein Concentration: Titrate protein concentrations (typically 0.1-10 μg/mL) to determine optimal stimulation conditions for different immune cell types
Endotoxin Removal: Ensure protein preparations are endotoxin-free (<0.1 EU/μg) to prevent non-specific immune activation
Cell Types: For bovine tuberculosis research, consider using:
Peripheral blood mononuclear cells (PBMCs)
Differentiated antigen-presenting cells co-cultured with autologous lymphocytes (ratio 1:10)
Macrophage cell lines for standardized assays
Incubation Time: Optimize based on readout (typically 16-24 hours for cytokine expression)
Controls: Include:
Non-stimulated cells (negative control)
Known immunostimulatory molecules (positive control)
Heat-inactivated protein (to distinguish activity from potential contaminants)
For measurement of immune responses, flow cytometry can be used to assess activation markers like CD25 on specific cell populations (e.g., WC1+ and NKp46+ cells), while RT-qPCR can quantify expression of immune mediators such as iNOS, IL-22, and IFN-γ .
Comparing wild-type and mutant forms of JTY_1518 requires careful experimental design to accurately assess functional differences. Based on approaches used with other M. bovis proteins, the following methodology is recommended:
Construct Generation:
PCR amplify wild-type JTY_1518 gene from reference strains
Introduce targeted mutations through site-directed mutagenesis
Clone both versions into identical expression vectors with the same tags
Verify constructs by sequencing to confirm mutations and rule out PCR errors
Expression and Purification:
Express both proteins under identical conditions
Purify using the same protocol (e.g., His-tag affinity chromatography)
Verify protein quality by SDS-PAGE and Western blot
Confirm similar yield and purity between preparations
Functional Comparisons:
Perform structural analysis (circular dichroism) to assess folding differences
Compare stability under various conditions
Assess binding to potential interaction partners
Evaluate immunostimulatory properties using standardized cellular assays
Data Analysis:
This approach has been successfully used for studying variants of other M. bovis proteins, such as ESAT-6, where a single amino acid change (T63A) significantly affected immunological properties .
Immunological studies with JTY_1518 generate complex datasets requiring appropriate statistical analysis. Based on published research with similar M. bovis proteins, the following statistical approaches are recommended:
For gene expression data (RT-qPCR):
Use reference genes like GAPDH for normalization
Apply the pair-wise fixed reallocation randomization test for comparing expression levels between infected and non-infected conditions
Calculate relative expression using the 2^(-ΔΔCT) method
Present data as mean values with standard error of the mean (SEM)
For flow cytometry data:
For bacterial load and functional assays:
For protein-protein interaction studies:
Quantify interaction strength using standardized metrics
Include appropriate positive and negative controls
Apply statistical tests appropriate for the experimental design
When reporting results, clearly state both the statistical test used and the precise p-values obtained, with significance typically set at p<0.05.
Contradictory results in JTY_1518 functional studies may arise from multiple factors. A systematic approach to reconciling such discrepancies includes:
Methodological Variations Assessment:
Compare protein preparation methods (expression system, purification approach, tags used)
Examine differences in protein concentration, buffer composition, and storage conditions
Evaluate experimental conditions (temperature, pH, incubation time)
Consider cell types and species differences in experimental models
Strain-Specific Effects Analysis:
Technical Validation:
Confirm protein identity and integrity by mass spectrometry
Verify activity using multiple independent assays
Assess endotoxin contamination that might confound immunological results
Examine batch-to-batch variation in protein preparations
Biological Context Consideration:
Evaluate the presence of co-factors that might affect protein function
Consider the influence of other bacterial components in the experimental system
Assess host cell activation status prior to experiments
When publishing results, transparently report all experimental conditions and acknowledge limitations of the study design to facilitate interpretation of apparently contradictory findings across studies.
Understanding the structure-function relationship of JTY_1518 requires a multi-technique approach. Based on structural biology best practices, the following methods are recommended:
A comprehensive approach would begin with computational predictions to guide experimental design, followed by targeted mutagenesis to validate the importance of specific residues or domains in JTY_1518 function within the bacterial cell or during host-pathogen interactions.
Genome-wide approaches offer powerful strategies for elucidating JTY_1518 function within the broader context of M. bovis biology. These approaches include:
Comparative Genomics:
Transcriptomics:
RNA-Seq analysis of wild-type versus JTY_1518 knockout strains
Identification of genes with correlated expression patterns
Determination of expression changes under different environmental conditions
Single-cell RNA-Seq to assess expression heterogeneity within bacterial populations
Proteomics:
Pull-down assays coupled with mass spectrometry to identify interaction partners
Quantitative proteomics to assess proteome-wide changes in JTY_1518 mutants
Protein turnover analysis to determine JTY_1518 stability under different conditions
Post-translational modification mapping
Functional Genomics:
Transposon mutagenesis screens to identify synthetic lethal interactions
CRISPR interference to assess essentiality under various conditions
Suppressor screens to identify genetic interactions
These approaches have been successfully applied to other M. bovis proteins and could provide valuable insights into JTY_1518 function, potentially revealing unexpected roles in bacterial physiology or host-pathogen interactions that are not evident from directed studies.