Recombinant Mycobacterium gilvum ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Structure and Function of ATP Synthase Subunit b (atpF)

The ATP synthase complex consists of two main functional units: F1 and F0 . The F1 sector is located in the cytoplasm and contains the catalytic sites for ATP synthesis, while the F0 sector is an integral membrane protein complex that facilitates proton translocation across the membrane . Subunit b (atpF) is a key component of the F0 sector, specifically forming part of the static stalk that connects F1 and F0 .

  • Role in Proton Translocation: The F0 sector contains a proton channel through which protons flow down their electrochemical gradient. This proton flow drives the rotation of the c-ring, which in turn drives ATP synthesis in the F1 sector . Subunit b helps to stabilize the F0 complex and is essential for efficient proton translocation .

Significance in Mycobacteria

Mycobacteria, such as Mycobacterium tuberculosis and Mycobacterium gilvum, have unique adaptations in their ATP synthase that are critical for their survival and pathogenesis .

  • Regulation of ATP Hydrolysis: Mycobacterial ATP synthases possess a latent ATPase activity, which prevents ATP-driven proton translocation . This is crucial for maintaining the proton motive force (pmf) and preventing the dissipation of ATP, especially under stress conditions . The C-terminal extension of subunit α plays a significant role in suppressing ATPase activity .

  • Drug Target: The ATP synthase of mycobacteria has been identified as a promising target for developing new anti-tuberculosis drugs . Bedaquiline (BDQ), for example, is an anti-TB drug that inhibits ATP synthase, preventing ATP production in Mycobacterium tuberculosis .

  • Adaptation to Hypoxia: Mycobacteria can regulate their energy (ATP) levels to survive under stringent living conditions . They slow down their respiratory rate and block ATP hydrolysis to maintain ATP homeostasis .

Research Findings

Recent research has provided valuable insights into the structure, function, and regulation of mycobacterial ATP synthase .

  • Inhibition of ATP Synthesis: Studies have identified inhibitors that target the mycobacterial F-ATP synthase, reducing NADH-driven ATP synthesis . For example, GaMF1 has been identified as a potent anti-TB inhibitor targeting the mycobacterial epitope .

  • C-Terminal Extension of Subunit α: The C-terminal extension of the nucleotide-binding subunit α contributes to suppressing ATPase activity in mycobacteria . Deletion of this region increases ATP hydrolysis while reducing ATP synthesis .

  • Structural Studies: Structural studies using electron cryomicroscopy have revealed details of the ATP synthase from Mycobacterium smegmatis, including the rotary mechanism and auto-inhibitory mechanisms . These findings provide potential targets for developing innovative antitubercular drugs .

  • Role of Cell Wall Synthesis Inhibitors: Inhibitors of cell wall synthesis cause a burst of intrabacterial ATP by increasing oxidative phosphorylation in Mycobacterium bovis .

Tables

Table 1: Effect of Cell Wall Synthesis Inhibitors on Intrabacterial ATP Levels in M. bovis BCG

DrugTargetEffect on ATP Levels
INHMycolic acid synthesisIncrease
EMBArabinogalactan synthesisIncrease
BTZ043Arabinogalactan synthesisIncrease
MEMPeptidoglycan synthesisIncrease
BDQOxidative phosphorylationDecrease
CCCPOxidative phosphorylationDecrease
PASCofactor synthesisNo effect
POACofactor synthesisNo effect
MXFNucleic acid/protein synthesisNo effect
RIFNucleic acid/protein synthesisNo effect
STRNucleic acid/protein synthesisNo effect

Table 2: Impact of α533-545 peptide on ATP synthesis

ConditionATP Synthesis Inhibition
Recombinant M. smegmatis F-ATP synthase72% at 50 µM
M. smegmatis IMVsInhibited

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
atpF; Mflv_2314; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Mycobacterium gilvum (strain PYR-GCK) (Mycobacterium flavescens (strain ATCC 700033 / PYR-GCK))
Target Names
atpF
Target Protein Sequence
MGDLTSTNLASAILAAEEGGGTSNFLLPNGTFFAVLLIFLIVLGVIAKWVVPPISKVLAE REAMLAKTAADNRKSAEQVAAARADYDKTLAEARGEASSIRDEARVAGRQVVDEKRATAN GEVAETVKTADEKLTQQGSAAQSELQSSVDALSATLASRILGVDVNTRGSQ
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation through the rotary mechanism of the central stalk subunits.

This protein is a component of the F0 channel, forming part of the peripheral stalk that links F1 and F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

How does the mycobacterial ATP synthase differ from ATP synthases in other bacterial species?

Mycobacterial F-ATP synthases possess several unique structural and functional characteristics that distinguish them from other bacterial homologs:

  • Latent ATPase activity: Unlike most bacterial ATP synthases, mycobacterial enzymes are incapable of ATP-driven proton translocation due to their suppressed ATPase activity. This prevents wasteful ATP hydrolysis and protects the proton motive force, which is essential for mycobacterial survival .

  • Unique subunit composition: Mycobacterial F-ATP synthases have an unusual stator stalk structure, with a subunit b/δ fusion protein and a separate subunit b′, resembling the arrangement in photosynthetic bacteria rather than the typical bacterial arrangement seen in E. coli .

  • Distinctive C-terminal extensions: Various subunits, particularly subunit α, contain mycobacteria-specific extensions that play regulatory roles. The C-terminal extension of subunit α (residues 514-549 in M. tuberculosis) has been demonstrated to suppress ATPase activity .

  • Adaptation to low proton motive force: Mycobacterial ATP synthases can function efficiently at a relatively low proton motive force (PMF) of approximately -110 mV, likely through adaptations in the c-ring structure and other components .

What are the optimized protocols for expression and purification of recombinant M. gilvum ATP synthase subunit b?

For successful expression and purification of recombinant M. gilvum ATP synthase subunit b, the following methodology is recommended:

Expression Systems:

  • Bacterial expression: E. coli BL21(DE3) or similar strains with pET-based vectors containing the atpF gene with an appropriate fusion tag (His6, GST, or MBP)

  • Alternative systems: Baculovirus-insect cell expression for improved folding of membrane proteins

Expression Protocol:

  • Transform expression vector into competent cells and select transformants

  • Grow cultures at 37°C to mid-log phase (OD₆₀₀ = 0.6-0.8)

  • Induce protein expression with 0.1-0.5 mM IPTG

  • Reduce temperature to 16-20°C post-induction for membrane proteins

  • Continue expression for 16-20 hours

Purification Strategy:

  • Cell lysis: Sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 5% glycerol, 1 mM PMSF, and protease inhibitor cocktail

  • Membrane fraction isolation: Ultracentrifugation at 100,000×g for 1 hour

  • Detergent solubilization: Resuspend membrane fraction in lysis buffer containing 1% n-dodecyl β-D-maltoside (DDM) or 1% digitonin

  • Affinity chromatography: Ni-NTA for His-tagged proteins or appropriate resin for other tags

  • Size exclusion chromatography: Final purification step using Superdex 200

Storage Conditions:

  • Store purified protein in Tris-based buffer containing 50% glycerol at -20°C or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles

  • Maintain working aliquots at 4°C for up to one week

How can researchers assess the functional integrity of purified recombinant atpF protein?

To verify both structural integrity and functional activity of purified recombinant atpF, researchers should employ a multi-technique approach:

Structural Integrity Assessment:

  • SDS-PAGE analysis: Confirm protein molecular weight (~19 kDa) and purity (>85%)

  • Western blotting: Using antibodies specific to atpF or tag epitopes

  • Circular dichroism (CD) spectroscopy: Analyze secondary structure content, expecting high α-helical content

  • Thermal shift assays: Evaluate protein stability and proper folding

  • Limited proteolysis: Assess folding quality by controlled enzymatic digestion

Functional Assessment:

  • Co-precipitation assays with partner subunits (e.g., subunit δ or other stator components)

  • Reconstitution into liposomes or nanodiscs for membrane proteins

  • Assembly assays with other F-ATP synthase components

  • Cross-linking studies to verify native interactions with partner proteins

  • ATP synthesis assays in reconstituted systems

Advanced Structural Analysis:

What experimental approaches can elucidate the role of atpF in the ATP synthesis mechanism?

To investigate the specific role of atpF in the ATP synthesis mechanism, researchers should consider these methodological approaches:

Genetic Manipulation:

  • Site-directed mutagenesis of conserved residues, particularly in regions interfacing with other subunits

  • Generation of deletion mutants targeting specific functional domains

  • Construction of chimeric proteins with atpF from organisms with different ATP synthase properties

  • CRISPR-Cas9 genome editing for in vivo studies in mycobacterial species

Biophysical Techniques:

  • Single-molecule FRET to monitor conformational changes during catalysis

  • Atomic force microscopy to measure mechanical stability of the stator stalk

  • Cryo-electron microscopy of assembled complexes with and without atpF mutations

  • Surface plasmon resonance to quantify binding kinetics with partner subunits

Functional Assays:

  • ATP synthesis measurements in inverted membrane vesicles from wild-type and mutant strains

  • Proton translocation assays using pH-sensitive fluorescent dyes

  • Rotation assays of single F₁-ATPase molecules using gold beads and high-speed imaging

  • ATP hydrolysis assays under varying conditions to detect regulatory effects

Computational Methods:

  • Molecular dynamics simulations of atpF in membrane environments

  • Protein-protein docking to predict interaction interfaces

  • Evolutionary analysis to identify conserved functional motifs

How does the structure of mycobacterial atpF contribute to the unique latent ATPase activity?

While the C-terminal extension of subunit α has been identified as a major contributor to latent ATPase activity in mycobacterial ATP synthases , subunit b (atpF) as part of the stator stalk may also play a significant role in this regulatory mechanism.

To investigate the contribution of atpF to latent ATPase activity, researchers should consider these approaches:

Structural Analysis:

  • Identify regions in atpF that interact with regulatory domains in other subunits (α, ε, and γ) through cross-linking and co-immunoprecipitation

  • Analyze the structure of the stator stalk-F₁ interface using cryo-EM or X-ray crystallography

  • Map conformational changes in atpF during different catalytic states using hydrogen-deuterium exchange mass spectrometry

Functional Studies:

  • Generate atpF mutations altering its interaction with the C-terminal extension of subunit α, which has been shown to suppress ATPase activity by affecting the angular velocity of the power stroke after ATP binding

  • Measure ATPase activity in reconstituted systems with wild-type versus mutant atpF

  • Compare ATPase activity in hybrid complexes containing atpF from mycobacteria versus bacteria with active ATPase function

Proposed Mechanism:
Based on existing data, the stator stalk including atpF likely stabilizes the entire F-ATP synthase complex in a conformation that supports ATP synthesis while restricting hydrolysis. The interaction between atpF and the regulatory domains of other subunits (particularly the C-terminal extension of subunit α that comes in proximity to subunit γ) may create a structural constraint that prevents the rotation necessary for robust ATP hydrolysis .

What are the key differences between M. gilvum atpF and homologous proteins from pathogenic mycobacteria?

Comparative analysis between M. gilvum atpF and homologs from pathogenic species provides insights into evolutionary adaptations and potential drug targets:

Sequence Comparison:
Alignment of atpF sequences from M. gilvum and pathogenic mycobacteria (M. tuberculosis complex) reveals:

  • High conservation in the transmembrane domain (>85% identity)

  • Greater variability in the cytoplasmic domain, particularly in regions interfacing with other subunits

  • Species-specific insertions/deletions that may relate to adaptation to different environmental niches

Structural Differences:

  • Variations in the length and composition of the connecting loop between the transmembrane and cytoplasmic domains

  • Differences in surface charge distribution affecting interactions with other subunits

  • Species-specific post-translational modification sites

Functional Implications:

  • Differences in ATP synthesis efficiency under various stress conditions

  • Variations in sensitivity to known ATP synthase inhibitors

  • Species-specific regulatory mechanisms affecting the balance between ATP synthesis and hydrolysis

These differences could be exploited for species-specific targeting, particularly for development of drugs against pathogenic mycobacteria that would not affect non-pathogenic environmental species.

How can atpF be targeted for development of novel antimycobacterial compounds?

The F-ATP synthase has emerged as a validated drug target for tuberculosis treatment, as evidenced by the clinical success of bedaquiline (TMC207) . While current drugs predominantly target subunit c, atpF presents additional opportunities for selective inhibition:

Target Site Identification:

  • Map the interaction interfaces between atpF and other subunits

  • Identify mycobacteria-specific regions absent in human homologs

  • Focus on regions critical for assembly or stability of the ATP synthase complex

  • Target sites affecting the regulatory mechanism of ATPase latency

Drug Discovery Approaches:

  • Structure-based virtual screening against atpF binding pockets

  • Fragment-based drug discovery targeting the stator stalk assembly

  • Peptidomimetic design based on critical interface regions

  • Natural product screening for compounds disrupting atpF interactions

Functional Assays:

  • ATP synthesis inhibition in mycobacterial membrane vesicles

  • Disruption of ATP synthase assembly monitored by blue native PAGE

  • Growth inhibition assays under varying energy conditions (aerobic vs. hypoxic)

  • Time-kill kinetics under different metabolic states

Novel Therapeutic Strategy:
Unlike conventional inhibitors that block ATP synthesis, compounds could be designed to activate the latent ATPase activity of mycobacterial ATP synthase. This would deplete ATP reserves and dissipate the proton motive force, which is lethal to mycobacteria . Targeting regulatory elements in atpF that maintain ATPase latency could provide a novel mechanism for antimycobacterial therapy.

What are the key technical challenges in working with recombinant mycobacterial membrane proteins like atpF?

Researchers face several methodological challenges when working with recombinant mycobacterial membrane proteins:

Expression Challenges:

  • Low expression yields due to toxicity or membrane targeting issues

  • Incorrect folding in heterologous expression systems

  • Inclusion body formation requiring refolding protocols

  • Difficulties in co-expression of multiple subunits for complex assembly

Purification Hurdles:

  • Selection of appropriate detergents that maintain native protein conformation

  • Optimization of solubilization conditions without compromising structure

  • Protein aggregation during concentration steps

  • Maintaining stability during purification procedures

Functional Assessment Complications:

  • Reconstitution into artificial membranes with appropriate lipid composition

  • Establishing reliable activity assays for individual subunits

  • Distinguishing intrinsic activity from effects of heterologous expression tags

  • Replicating the unique mycobacterial membrane environment

Potential Solutions:

  • Use of mycobacterial-specific expression systems or cell-free systems

  • Nanodiscs or styrene-maleic acid lipid particles (SMALPs) for membrane protein stabilization

  • Co-expression with chaperones specific for membrane protein folding

  • Fusion with solubility-enhancing partners that can be later removed

How can researchers overcome inconsistencies in functional data when studying isolated atpF versus the complete ATP synthase complex?

When studying isolated subunits versus complete complexes, researchers often encounter contradictory functional data. Methodological approaches to address these inconsistencies include:

Experimental Design Considerations:

  • Develop step-wise reconstitution systems progressing from minimal subunit combinations to complete complexes

  • Use complementary functional assays that measure different aspects of activity

  • Implement controls with known inhibitors to validate assay sensitivity

  • Include cross-validation using multiple expression systems

Data Integration Approaches:

  • Create mathematical models that account for differences between isolated and complex-integrated activities

  • Use structural data from isolated subunits to inform complete complex models

  • Apply systems biology approaches to understand emergent properties

  • Develop correction factors based on empirical observations of activity differences

Technical Refinements:

  • Standardize buffer conditions, detergents, and lipid compositions across experiments

  • Implement rigorous quality control for protein preparations

  • Utilize internal standards for normalization across experiments

  • Develop native mass spectrometry protocols to verify complex assembly

By implementing these methodological approaches, researchers can better reconcile data from isolated subunits with the behavior of the complete ATP synthase complex, leading to more accurate understanding of structure-function relationships.

What are the emerging techniques for studying dynamic protein-protein interactions involving atpF during ATP synthesis?

Recent technological advances have enabled more sophisticated analysis of dynamic interactions in ATP synthase:

Time-Resolved Structural Techniques:

  • Time-resolved cryo-EM to capture different conformational states during the catalytic cycle

  • High-speed atomic force microscopy (HS-AFM) for real-time visualization of structural changes

  • Single-molecule FRET with improved time resolution to monitor distance changes between subunits

  • Mass photometry for studying assembly kinetics and subunit stoichiometry

Advanced Biophysical Methods:

  • Microfluidic approaches for rapid mixing and time-resolved structural analysis

  • Neutron scattering combined with selective deuteration to focus on specific subunits

  • Native mass spectrometry with improved sensitivity for membrane protein complexes

  • Cross-linking mass spectrometry with cleavable linkers for dynamic interaction mapping

Computational Approaches:

  • Molecular dynamics simulations at extended timescales using specialized hardware

  • Machine learning-based prediction of conformational changes

  • Coarse-grained modeling to capture large-scale motions in the ATP synthase

  • Network analysis of cooperativity between distant subunits

These emerging techniques promise to reveal the dynamic interactions of atpF with other ATP synthase components during the catalytic cycle, potentially uncovering new mechanisms for regulation and inhibition.

How does research on M. gilvum atpF contribute to understanding drug resistance mechanisms in pathogenic mycobacteria?

Studies on M. gilvum atpF can provide valuable insights into drug resistance mechanisms in pathogenic mycobacteria:

Comparative Analysis Framework:

  • Identifying conserved functional domains versus variable regions between species

  • Mapping mutations in clinical isolates to homologous positions in M. gilvum atpF

  • Predicting cross-resistance patterns based on structural similarities

  • Understanding species-specific adaptations that might confer intrinsic resistance

Experimental Applications:

  • Development of M. gilvum as a safer model system for preliminary drug screening

  • Creation of chimeric proteins to identify regions responsible for differential drug sensitivity

  • Site-directed mutagenesis to reproduce clinical resistance mutations in laboratory strains

  • Evolution experiments in M. gilvum to predict potential resistance mechanisms

Translational Potential:

  • Design of drugs with broader spectrum against multiple mycobacterial species

  • Identification of conserved vulnerabilities less prone to resistance development

  • Development of combination therapies targeting multiple ATP synthase subunits

  • Creation of diagnostic tools to rapidly identify resistance-associated mutations

By leveraging research on non-pathogenic M. gilvum, researchers can accelerate drug discovery efforts while minimizing biosafety concerns associated with work on pathogenic mycobacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.