Recombinant Mycobacterium gilvum NADH-quinone oxidoreductase subunit K (nuoK)

What is the amino acid sequence and structural characteristics of Mycobacterium gilvum NADH-quinone oxidoreductase subunit K (nuoK)?

The full-length Mycobacterium gilvum NADH-quinone oxidoreductase subunit K (nuoK) protein consists of 99 amino acids with the following sequence:

MNPDNYLYLSALLFTIGAAGVLLRRNAIVMFMCVELMLNAGNLAFVTFARVHGNLDGQVVAFFTMVVAACEVVIGLAIIMTIFRTRRSANVDAASLLRH

This sequence reveals several key structural features:

• Multiple hydrophobic regions consistent with a membrane-spanning protein

• Conserved residues likely involved in proton translocation

• Characteristic motifs common to respiratory complex I components

• A predominantly α-helical structure predicted for the transmembrane domains

When prepared as a recombinant protein, nuoK is typically expressed with an N-terminal His-tag to facilitate purification while preserving the native C-terminus, which may contain functional elements critical for complex assembly or activity .

What expression systems are most effective for producing functional recombinant Mycobacterium gilvum nuoK?

The preferred expression system for recombinant Mycobacterium gilvum nuoK is Escherichia coli, which offers several advantages for the production of this mycobacterial membrane protein:

• Rapid growth kinetics and high protein yields

• Well-established genetic manipulation protocols

• Compatibility with the expression of prokaryotic membrane proteins

• Simplified purification workflows, particularly for His-tagged constructs

For optimal expression, the full-length protein (amino acids 1-99) is typically cloned into expression vectors containing:

• Strong but inducible promoters (T7 or tac)

• N-terminal His-tags for purification

• Appropriate signal sequences if needed for membrane targeting

Specialized E. coli strains such as C41(DE3) or C43(DE3), which are engineered for membrane protein expression, often yield better results than standard BL21(DE3) strains. Expression at reduced temperatures (16-25°C) after induction is generally recommended to enhance proper folding and membrane integration .

What protocols ensure optimal purification and storage of recombinant Mycobacterium gilvum nuoK?

Successful purification and storage of recombinant Mycobacterium gilvum nuoK requires careful attention to maintaining protein stability and conformation. The following methodological approach is recommended:

Purification Protocol:

• Cell lysis under mild conditions (sonication or French press)

• Membrane fraction isolation by differential centrifugation

• Solubilization with appropriate detergents (typically n-dodecyl-β-D-maltoside)

• Immobilized metal affinity chromatography (IMAC) using the His-tag

• Optional size exclusion chromatography for enhanced purity

Storage Conditions:

• Short-term storage: 4°C for up to one week

• Long-term storage: -20°C or -80°C

• Storage buffer: Tris/PBS-based buffer containing 6% trehalose, pH 8.0

• Recommended aliquoting to avoid repeated freeze-thaw cycles

Reconstitution Protocol:

• Centrifuge lyophilized protein briefly before opening

• Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is standard)

• Prepare working aliquots to minimize repeated freezing and thawing

This systematic approach maximizes protein stability while preserving structural integrity and functional activity essential for downstream applications.

What functional assays can determine the activity of recombinant Mycobacterium gilvum nuoK?

Assessing the functional activity of recombinant Mycobacterium gilvum nuoK requires approaches that evaluate both its individual properties and its role within the NADH:quinone oxidoreductase complex. The following methodological assays are recommended:

Primary Activity Assays:

• NADH oxidation assays: Spectrophotometric monitoring of NADH consumption (absorbance decrease at 340 nm) in membrane preparations or reconstituted systems containing nuoK

• Electron transfer measurements: Using artificial electron acceptors like ferricyanide or dichlorophenolindophenol

• Proton translocation assays: Monitoring pH changes or using pH-sensitive fluorescent probes

Complementary Functional Assessments:

• ROS production monitoring: Using Amplex Red fluorescence assays to detect hydrogen peroxide generation during electron transfer

• Membrane potential measurements: Employing potential-sensitive dyes to assess the contribution to proton motive force

• Inhibitor sensitivity profiles: Testing responses to known Complex I inhibitors (e.g., rotenone, piericidin A)

It's important to note that as a membrane subunit, nuoK's full functionality is best assessed within the context of the assembled Complex I or in membrane preparations rather than as an isolated subunit. Reconstitution into proteoliposomes may be necessary for certain functional studies.

How does Mycobacterium gilvum nuoK contribute to the structure and mechanism of NADH:quinone oxidoreductase complex?

The nuoK subunit plays a crucial role in the structure and mechanism of the mycobacterial NADH:quinone oxidoreductase complex (Complex I), contributing to both its assembly and proton translocation function. Based on structural and functional studies of comparable systems, the following mechanisms can be proposed:

Structural Contributions:

• Forms part of the membrane domain of Complex I

• Contains transmembrane helices that contribute to proton channels

• Interacts with adjacent membrane subunits (likely nuoJ, nuoL, and nuoM)

• May participate in quinone binding pocket formation

Mechanistic Roles:

• Proton Translocation: Contains conserved residues that likely form part of the proton translocation pathway

• Conformational Coupling: Transmits conformational changes between the peripheral arm and membrane domain

• Complex Stability: Provides structural integrity to the membrane domain

Proposed Mechanism Model:

This mechanistic model suggests that nuoK functions as an integral component of the proton pumping machinery, converting the energy of electron transfer into the mechanical work of proton translocation across the mycobacterial membrane .

How can recombinant Mycobacterium gilvum nuoK be utilized for structure-function relationship studies?

Investigating the structure-function relationship of recombinant Mycobacterium gilvum nuoK requires a strategic combination of structural biology approaches and functional analyses. The following methodological framework is recommended:

Structural Determination Approaches:

• Cryo-electron microscopy (Cryo-EM): For visualization of nuoK within the complete Complex I structure

• X-ray crystallography: Challenging for membrane proteins but potentially feasible with appropriate crystallization conditions

• NMR spectroscopy: For dynamics studies of specific domains or reconstituted preparations

• Computational modeling: Homology modeling based on related structures from other species

Mutagenesis Strategies:

• Alanine scanning: Systematic replacement of conserved residues to identify essential amino acids

• Conservative substitutions: Replacing residues with similar properties to fine-tune functional hypotheses

• Chimeric constructs: Swapping regions between nuoK from different species to identify species-specific functions

Structure-Function Correlation Methods:

• Site-directed spin labeling: For measuring distances and conformational changes

• Intragenic suppressor analysis: Identifying compensatory mutations that restore function

• Cross-linking studies: Mapping protein-protein interactions within the complex

Expected Outcomes Table:

What comparative insights can be gained from studying nuoK across different mycobacterial species?

Comparative analysis of nuoK across different mycobacterial species reveals important evolutionary patterns and functional adaptations within this protein family. This approach yields valuable insights into conservation patterns, species-specific variations, and potential functional implications:

Sequence Conservation Analysis:

*Estimated values based on typical conservation patterns in mycobacterial respiratory proteins.

Functional Domain Comparison:

• Transmembrane helices: Highly conserved across species, reflecting structural constraints

• Proton channel residues: Near-identical conservation, indicating functional importance

• Species-specific regions: Variable loops or termini, potentially related to specific ecological niches

• Interaction interfaces: Subtle variations that may affect assembly with other complex subunits

Methodological Approaches for Comparative Studies:

• Phylogenetic analysis: Construction of evolutionary trees based on nuoK sequences

• Homology modeling: Generation of structural models for different species variants

• Heterologous complementation: Testing functional equivalence through cross-species expression

• Chimeric protein construction: Creating hybrid proteins to map species-specific functions

These comparative approaches can reveal how nuoK has evolved within the Mycobacterium genus to support different lifestyles (pathogenic vs. environmental) and metabolic capabilities, providing insights into both fundamental biology and potential species-specific targeting strategies .