Recombinant Mycobacterium gilvum UPF0353 protein Mflv_3659 (Mflv_3659)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if necessary. We will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance to arrange dry ice shipping; additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your application.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Note: The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Mflv_3659; UPF0353 protein Mflv_3659
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Mycobacterium gilvum (strain PYR-GCK) (Mycobacterium flavescens (strain ATCC 700033 / PYR-GCK))
Target Names
Mflv_3659
Target Protein Sequence
MTLPLLGPMSLSGFEHPWFFLFFFVVIGLVALYIVVQLARQKRMLRFANMELLESVAPKQ PSRMRHLPAVLMILSLVSFTIAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATDVAPNRLT AAQEAAKQFADQLTPGINLGLIAYAGTATVLVSPTTNRESTKTAIDKLQLADRTATGEGI FTALQAIATVGAVIGGGDEPPPARVVLMSDGKETVPSNPDNPKGAYTAARTAKDQGVPIS TVSFGTPYGYVEINEQRQPVPVDDEMLKKIADLSGGEAFTASSLEQLKQVFTNLQEQIGY ETIKGDASVGWLRLGAGVLALAALGALLINRRLPN
Uniprot No.

Target Background

Database Links
Protein Families
UPF0353 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mycobacterium gilvum UPF0353 protein Mflv_3659?

Mycobacterium gilvum UPF0353 protein Mflv_3659 (UniProt ID: A4T9I4) is a full-length protein (335 amino acids) derived from Mycobacterium gilvum, an environmental mycobacterium primarily isolated from river sediments. This bacterium was formerly known as Mycobacterium flavescens and has been noted for its ability to degrade polycyclic aromatic hydrocarbons, which enables it to use compounds such as pyrene as a sole source of carbon and energy . The UPF0353 protein belongs to a family of proteins with currently uncharacterized function, as indicated by the UPF (Uncharacterized Protein Family) designation. The recombinant version is typically produced with an N-terminal His-tag to facilitate purification and experimental applications .

How should recombinant Mflv_3659 protein be reconstituted for experimental use?

The recommended reconstitution protocol for lyophilized recombinant Mflv_3659 protein involves several carefully controlled steps to maintain protein integrity:

  • Briefly centrifuge the vial before opening to ensure all material settles at the bottom.

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (the standard recommendation is 50%) to stabilize the protein for long-term storage.

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles.

This methodological approach helps preserve protein structure and function for downstream applications. The addition of glycerol is particularly important as it prevents ice crystal formation during freezing, which can denature proteins .

What experimental approaches have been used to study Mycobacterium gilvum interactions with host cells?

Research on Mycobacterium gilvum interactions with host cells has utilized multiple complementary experimental approaches:

  • Co-culture systems: M. gilvum has been studied in co-culture with Acanthamoeba polyphaga strain Linc-AP1 trophozoites to assess bacterial survival and potential pathogenicity.

  • Microscopy techniques:

    • Optical microscopy for visualization of infection rates and basic interactions

    • Electron microscopy for detailed ultrastructural analysis of M. gilvum localization within host cells

  • Quantitative microbial enumeration: Culture-based counting methods to determine bacterial survival rates and growth patterns during infection.

These methodologies revealed that approximately 29% of A. polyphaga cells became infected by M. gilvum within 6 hours post-infection. Notably, surviving M. gilvum bacteria did not multiply within or kill the amoebal trophozoites during a 5-day co-culture period .

How does the size of Mycobacterium gilvum relate to its interaction with amoebae?

Research has demonstrated a significant correlation between mycobacterial cell size and interaction patterns with amoebae. Extensive electron microscopy observations have established that:

Mycobacterium SpeciesAverage SizeGrowth Within AmoebaeAmoebal Killing
M. gilvum1.4 ± 0.5 μmNo significant growthNo
M. rhodesiae<2 μmNo significant growthNo
M. thermoresistibile<2 μmNo significant growthNo
Other mycobacteria>2 μmSignificant growthYes

Statistical analysis confirmed that mycobacteria measuring <2 μm (including M. gilvum) exhibit significantly different amoeba-mycobacterium relationships compared to larger mycobacteria measuring >2 μm (p<0.05). Specifically, M. gilvum can survive within amoebal trophozoites but does not replicate or cause host cell death, whereas larger mycobacterial species tend to multiply within and kill amoebal trophozoites .

What are the optimal storage conditions for recombinant Mflv_3659 protein?

Proper storage of recombinant Mflv_3659 protein is critical for maintaining its structural integrity and biological activity. The recommended storage protocol includes:

  • Short-term storage (up to one week): Store working aliquots at 4°C.

  • Long-term storage: Store at -20°C or preferably -80°C upon receipt.

  • Buffer composition: Tris/PBS-based buffer containing 6% Trehalose, pH 8.0.

  • Critical consideration: Avoid repeated freeze-thaw cycles as they significantly reduce protein stability and activity.

These storage recommendations are based on established protein biochemistry principles that aim to minimize protein denaturation, aggregation, and proteolytic degradation. The addition of trehalose in the storage buffer acts as a cryoprotectant and stabilizing agent .

How can researchers design experiments to investigate the functional role of UPF0353 protein in Mycobacterium gilvum?

Investigating the functional role of UPF0353 protein requires a multi-faceted experimental approach:

  • Gene knockout/knockdown studies:

    • Generate M. gilvum strains with deleted or silenced Mflv_3659 gene using CRISPR-Cas9 or homologous recombination techniques

    • Compare phenotypic changes in growth rate, biofilm formation, and polycyclic aromatic hydrocarbon degradation between wildtype and knockout strains

    • Assess alterations in virulence using amoeba infection models

  • Protein-protein interaction studies:

    • Implement pull-down assays using the His-tagged recombinant protein to identify binding partners

    • Perform yeast two-hybrid screening or proximity labeling techniques (BioID or APEX)

    • Validate interactions with co-immunoprecipitation and western blotting

  • Structural analysis:

    • Conduct X-ray crystallography or cryo-electron microscopy to determine three-dimensional structure

    • Perform in silico structure prediction and homology modeling to identify potential functional domains

    • Use molecular dynamics simulations to predict protein behavior and functional motifs

  • Transcriptomic and proteomic profiling:

    • Compare gene/protein expression patterns between wildtype and Mflv_3659-deficient strains under various environmental conditions

    • Identify genes/proteins with co-regulated expression patterns that might function in the same biological pathway

These methodological approaches, used in combination, can provide complementary data to elucidate the functional significance of this currently uncharacterized protein .

What methods can be used to analyze potential contradictions in research findings about Mflv_3659?

Resolving contradictions in research findings about Mflv_3659 requires systematic contextual analysis using these methodological approaches:

  • Identification of contextual variables:

    • Experimental conditions (temperature, pH, buffer composition)

    • Organismal variables (strain differences, growth phase)

    • Methodological variations (assay sensitivity, detection methods)

  • Structured contradiction analysis framework:

    • Classify contradictions as apparent (resolvable through context) or fundamental

    • Identify underspecified contexts that may explain discrepancies, including:

      • Species/strain differences

      • Temporal context variations

      • Environmental phenomena

  • Meta-analysis techniques:

    • Pool data from multiple studies using statistical methods that account for inter-study heterogeneity

    • Weight findings based on methodological rigor and sample size

    • Identify moderator variables that explain divergent results

  • Text mining and automated contradiction detection:

    • Implement natural language processing to extract claims from literature

    • Compute polarity of claims to identify potentially contradictory statements

    • Analyze supporting context to resolve apparent contradictions

This methodological framework helps researchers distinguish between truly contradictory findings and those that appear contradictory due to incomplete context specification, a common issue in biomedical literature .

How does the membrane association pattern of Mflv_3659 influence experimental design for localization studies?

The amino acid sequence of Mflv_3659 suggests it contains hydrophobic regions that may indicate membrane association. This characteristic requires specialized experimental approaches for accurate localization studies:

  • Subcellular fractionation techniques:

    • Differential centrifugation to separate cellular components

    • Sucrose gradient ultracentrifugation for membrane fraction isolation

    • Western blot analysis of fractions using anti-His antibodies for the recombinant protein

  • Fluorescence microscopy approaches:

    • Generate fluorescent protein fusions (GFP-Mflv_3659) for live-cell imaging

    • Implement super-resolution microscopy (STED, PALM, or STORM) for nanoscale localization

    • Use FRAP (Fluorescence Recovery After Photobleaching) to assess protein mobility within membranes

  • Membrane topology analysis:

    • Protease protection assays to determine orientation relative to the membrane

    • Site-directed fluorescence labeling at predicted loop regions

    • Implement substituted cysteine accessibility method (SCAM) to map transmembrane domains

  • Lipid interaction studies:

    • Liposome binding assays with purified recombinant protein

    • Detergent solubility profiling to assess membrane microdomain association

    • Use of photoactivatable lipid probes to identify specific lipid interactions

These methodological considerations are essential when designing experiments to determine the precise subcellular localization of Mflv_3659, especially given its potential membrane association as suggested by its amino acid sequence with hydrophobic regions .

What are the promising future research directions for Mflv_3659?

Several high-priority research directions for Mflv_3659 deserve consideration:

  • Functional characterization:

    • Determine the precise biological role of Mflv_3659 in Mycobacterium gilvum physiology

    • Investigate potential involvement in polycyclic aromatic hydrocarbon degradation pathways

    • Assess contribution to environmental adaptation and survival

  • Structural biology approaches:

    • Resolve three-dimensional structure through X-ray crystallography or cryo-EM

    • Identify functional domains and catalytic sites

    • Compare structural homology with characterized proteins in other bacterial species

  • Host-pathogen interaction studies:

    • Expand beyond amoeba models to investigate potential interactions with other environmental hosts

    • Determine if Mflv_3659 plays a role in survival within host cells

    • Assess contribution to biofilm formation and environmental persistence

  • Biotechnological applications:

    • Evaluate potential use in bioremediation of contaminated environments

    • Explore enzyme engineering for industrial applications

    • Investigate as a potential target for environmental monitoring

These research directions build upon current knowledge while addressing significant gaps in our understanding of this uncharacterized protein. Collaborative approaches combining molecular biology, structural biology, and environmental microbiology methodologies will be essential for comprehensive characterization of Mflv_3659 .

How can researchers address the challenges of working with hydrophobic membrane proteins like Mflv_3659?

Working with potentially membrane-associated proteins like Mflv_3659 presents specific technical challenges that can be addressed through specialized methodological approaches:

  • Expression optimization strategies:

    • Test multiple expression systems (bacterial, yeast, insect, mammalian)

    • Evaluate fusion partners that enhance solubility (MBP, SUMO, thioredoxin)

    • Implement auto-induction media or specialized induction protocols

    • Consider cell-free expression systems for toxic proteins

  • Purification optimization:

    • Select appropriate detergents for membrane protein solubilization

    • Implement detergent screening platforms to identify optimal extraction conditions

    • Use native nanodiscs or styrene-maleic acid lipid particles (SMALPs) for detergent-free extraction

    • Optimize buffer composition with stabilizing additives

  • Functional reconstitution approaches:

    • Reconstitute purified protein into liposomes for functional studies

    • Utilize proteoliposomes for transport or enzymatic assays

    • Apply solid-supported membrane electrophysiology for functional characterization

  • Structural analysis adaptations:

    • Implement lipidic cubic phase crystallization for membrane proteins

    • Consider NMR approaches for dynamics studies

    • Apply hydrogen-deuterium exchange mass spectrometry for conformational analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.