Recombinant Mycobacterium leprae Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Biological Function

LspA is a type II signal peptidase (EC 3.4.23.36) responsible for processing lipoproteins in M. leprae . Its enzymatic activity enables:

  • Lipoprotein Maturation: Cleaves N-terminal signal peptides from prolipoproteins, facilitating their integration into the bacterial cell membrane .

  • Pathogen Survival: Critical for maintaining cell envelope integrity, which is necessary for intracellular survival in macrophages and Schwann cells .

  • Host Interaction: Processed lipoproteins may modulate host immune responses, though specific mechanisms in M. leprae remain under investigation .

Vaccine Development

  • Antigen Candidate: Recombinant LspA is used in preclinical studies to evaluate its immunogenicity for potential inclusion in subunit vaccines .

  • Adjuvant Compatibility: Tested alongside toll-like receptor agonists to enhance T-cell responses in murine models .

Diagnostic Tools

  • Serological Assays: While not yet commercialized, LspA’s specificity makes it a candidate for antibody-detection assays, similar to the 35-kDa protein used in leprosy diagnostics .

Functional Studies

  • Drug Target Screening: Used in high-throughput assays to identify inhibitors targeting lipoprotein processing, a pathway absent in humans .

Immune Response Profiling

  • T-Cell Reactivity: Preliminary studies suggest LspA-derived peptides elicit gamma interferon (IFN-γ) responses in leprosy patients, similar to Lsr2 and ND-O-LID antigens .

  • Antibody Recognition: Sera from multibacillary (MB) patients show higher antibody titers against recombinant mycobacterial proteins compared to paucibacillary (PB) cases .

Comparative Efficacy

AntigenSensitivity (MB)SpecificityUtility
LspA (theoretical)Not yet reportedHigh (predicted)Vaccine research, mechanism studies
35-kDa Protein90-100%95%Serodiagnosis
ND-O-LID85% (MB), 60% (PB)90%Field diagnostics

Challenges and Future Directions

  • Limited Clinical Data: Most studies focus on in vitro or animal models; human trials are needed to validate diagnostic or therapeutic potential .

  • Cross-Reactivity Risks: Homology with M. tuberculosis proteins necessitates specificity validation to avoid false positives .

  • Stability Issues: Recombinant LspA requires storage at -80°C with glycerol to prevent aggregation, complicating field applications .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we currently have in stock. If you have specific requirements for the format, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Please note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; MLBr01199; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Mycobacterium leprae (strain Br4923)
Target Names
lspA
Target Protein Sequence
MMGRVPDGPTGLAALVPSVEEAQAMLPPRRLRLLLSIAAVVLTLDIVTKVLAVKFLLPGK SVSIIGDTVTWTLVRNSGAAFSMATGYTWVLTLIATGVVIGIFWMGRRLVSSWWALGLGM ILGGAMGNLVDRFFRAPAPLRGHVVDFLSIGWWPVFNVADPSVVVGAILLVVLSIFGFDF DTVGRRKAEFDIAGQRKAEQR
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of lspA in Mycobacterium leprae?

Lipoprotein signal peptidase (lspA) in M. leprae specifically catalyzes the removal of signal peptides from prolipoproteins during the maturation process of bacterial lipoproteins. This enzyme belongs to the peptidase A8 family and serves as an essential component in the lipoprotein processing pathway. Similar to other gram-negative bacteria, M. leprae's lspA functions as a Type II Signal Peptidase (SPase II) that processes prolipoproteins after they have been modified by diacylglyceryl transferase .

The functional importance of lspA can be understood within the broader context of bacterial protein secretion, where it plays a specialized role in the processing of lipid-modified proteins that are typically destined for the bacterial cell envelope. While Type I signal peptidases (encoded by lepB) process the majority of secreted proteins, SPase II focuses specifically on the subset of proteins that undergo lipid modification .

How does lspA interact with other components of the lipoprotein processing pathway?

Recombinant M. leprae lspA functions within a coordinated lipoprotein processing pathway that involves several enzymatic steps. Based on STRING database interaction analysis, lspA has strong predicted functional relationships with:

  • ML1274 (Prolipoprotein diacylglyceryl transferase) - This enzyme catalyzes the transfer of a diacylglyceryl group to the N-terminal cysteine of prolipoproteins, which is the first step in lipoprotein maturation (interaction score: 0.957) .

  • ML1441 (Apolipoprotein N-acyltransferase) - Responsible for the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoproteins, which represents the final step in lipoprotein maturation (interaction score: 0.943) .

The sequential processing of bacterial lipoproteins typically follows this order: the prolipoprotein is first modified by prolipoprotein diacylglyceryl transferase (Lgt), then the signal peptide is cleaved by lipoprotein signal peptidase (LspA), and finally, the N-terminal cysteine is acylated by apolipoprotein N-acyltransferase. This pathway appears to be conserved across bacterial species, including mycobacteria .

What experimental methods can confirm the functionality of recombinant M. leprae lspA?

Based on studies with other bacterial lspA proteins, researchers can employ several approaches to verify the functionality of recombinant M. leprae lspA:

  • Globomycin Resistance Assay: Overexpression of functional lspA in E. coli confers increased resistance to globomycin, a specific inhibitor of SPase II. This approach has been validated with R. typhi lspA and provides a practical method to assess SPase II activity .

  • Genetic Complementation: Recombinant lspA can be tested for its ability to restore growth of temperature-sensitive E. coli strains (such as E. coli Y815) at non-permissive temperatures. The degree of growth restoration indicates the biological activity of the recombinant enzyme in prolipoprotein processing .

  • Expression Pattern Analysis: Real-time quantitative reverse transcription-PCR (qRT-PCR) can be used to monitor the transcription patterns of lspA along with other genes involved in lipoprotein processing (lgt) and protein secretion (lepB) during various stages of bacterial growth .

It should be noted that when R. typhi lspA was tested in E. coli complementation systems, it showed significantly lower complementation efficiency compared to E. coli's native lspA, despite conferring similar globomycin resistance. This suggests that while the fundamental SPase II activity may be conserved, species-specific differences may affect the enzyme's efficiency in heterologous systems .

How does the expression of lspA vary during different growth phases, and what implications does this have for experimental design?

Research on related rickettsial species provides insights into the potential expression patterns of lipoprotein processing genes in intracellular bacteria. In R. typhi, lspA expression showed distinct patterns during different stages of intracellular growth:

  • Pre-infection phase: Higher transcriptional levels of lspA, lgt, and lepB were observed, suggesting that metabolically active bacteria with functional protein secretion systems are better prepared for infection and host cell phagocytosis .

  • Early post-infection phase (0-8 hours): Expression levels decrease after initial host cell entry .

  • Logarithmic growth phase (8-48 hours): Expression increases again, peaking at approximately 48 hours post-infection .

  • Late infection/host cell lysis phase (120 hours): Decreased expression as infected host cells begin to detach .

These expression patterns have important implications for experimental design when working with recombinant M. leprae lspA:

  • Timing of sample collection: Researchers should carefully consider the growth phase when harvesting bacteria for lspA expression or functional studies.

  • Comparative analysis: The similar expression patterns of lspA and lgt suggest coordinated regulation of the lipoprotein processing pathway, while the higher expression of lepB indicates its broader role in processing non-lipoprotein secretory proteins .

  • Functional significance: The elevated expression at pre-infection stages suggests that lipoprotein processing may be particularly important for initial host-pathogen interactions.

What structural features differentiate M. leprae lspA from other bacterial SPase II enzymes?

While detailed structural information specific to M. leprae lspA is limited in the provided search results, comparative analysis with other bacterial SPase II enzymes reveals several important considerations:

  • Conserved catalytic domains: Alignment of deduced amino acid sequences typically shows highly conserved residues and domains that are essential for SPase II activity in lipoprotein processing across bacterial species .

  • Membrane integration: As a signal peptidase, lspA is expected to be integrated into the bacterial membrane, with specific hydrophobic domains facilitating this localization.

  • Sequence divergence: The relatively low sequence identity (approximately 22%) between rickettsial SPase II and E. coli SPase II may explain the reduced complementation efficiency observed in heterologous systems while maintaining the ability to bind specific inhibitors like globomycin .

  • Mycobacteria-specific features: M. leprae lspA likely shares structural features with other mycobacterial signal peptidases, which may be optimized for the unique cell envelope structure of mycobacteria.

Researchers working with recombinant M. leprae lspA should consider these structural features when designing expression systems, purification protocols, and functional assays.

How can researchers overcome challenges in expressing and purifying functional recombinant M. leprae lspA?

Working with recombinant M. leprae lspA presents several challenges, primarily due to its nature as a membrane protein and the unique biological characteristics of mycobacteria. Based on experimental approaches used with other bacterial signal peptidases, researchers can implement the following strategies:

  • Expression system optimization:

    • Consider mycobacterial expression hosts (such as M. smegmatis) that may provide a more native environment for proper folding and membrane integration

    • Test different E. coli strains specifically designed for membrane protein expression

    • Evaluate the effect of fusion tags (His, GST, MBP) on solubility and activity

    • Optimize growth temperature, typically using lower temperatures (16-25°C) to improve proper folding

  • Solubilization and purification strategies:

    • Screen multiple detergents for effective solubilization of the membrane-integrated lspA

    • Consider nanodisc or liposome reconstitution for maintaining native-like membrane environment

    • Implement stepwise purification protocols that maintain enzyme activity

    • Evaluate the impact of lipid composition on enzyme stability and activity

  • Functionality assessment:

    • Develop in vitro assays using synthetic peptide substrates that mimic M. leprae prolipoproteins

    • Consider fluorescence-based assays for monitoring peptide cleavage

    • Validate activity through globomycin inhibition studies

    • Assess membrane integration through protease accessibility assays

Based on experience with R. typhi lspA, researchers should anticipate potential challenges with genetic complementation efficiency in E. coli systems, which may require optimization of expression conditions or use of alternative complementation systems closer to mycobacterial cellular environments .

What is the relationship between M. leprae lspA and its homologs in related mycobacterial species?

Evolutionary analysis of mycobacterial species provides important context for understanding M. leprae lspA:

Researchers studying M. leprae lspA should consider comparative analysis with homologs from other mycobacterial species, particularly those that are more genetically tractable (such as M. tuberculosis or M. smegmatis), to gain insights into conserved functions and species-specific adaptations.

What is the predicted lipoprotein profile of M. leprae and how does this relate to lspA function?

In silico analysis of bacterial genomes can provide valuable insights into the potential substrates of lspA. Comparable analysis in R. typhi revealed:

  • Secretome composition: Out of 838 annotated open reading frames (ORFs) in the R. typhi genome, 89 were identified as secretory proteins containing putative signal peptide sequences .

  • Lipoprotein proportion: Among these 89 predicted secretory proteins, only 14 were recognized as putative lipoproteins, suggesting that lipoproteins constitute a relatively small fraction of the total secretome .

  • Processing pathway implications: The higher transcriptional level of lepB (encoding SPase I) compared to lspA and lgt correlates with the prediction that SPase I processes more secretory proteins than SPase II does .

While specific data for M. leprae's lipoprotein profile is not directly provided in the search results, the approach used for R. typhi (combining SignalP and LipoP prediction tools) could be applied to analyze the M. leprae genome. The reduced genome size of M. leprae compared to other mycobacteria suggests a potentially smaller but specialized lipoprotein repertoire that may influence lspA substrate specificity and expression levels.

What experimental design approaches are most appropriate for studying recombinant M. leprae lspA function?

When designing experiments to investigate recombinant M. leprae lspA function, researchers should consider various experimental design approaches:

  • Independent Groups Design:

    • This approach uses different participants (or experimental units) for each condition, which in biological research translates to using separate bacterial cultures for different experimental treatments .

    • Strengths: Eliminates order effects; allows simultaneous testing of multiple conditions .

    • Weaknesses: Requires more biological material; individual differences between cultures may introduce variability .

    • Application to lspA research: Appropriate for comparing wild-type vs. recombinant lspA expression, or testing different inhibitors.

  • Repeated Measures Design:

    • Uses the same participants (experimental units) across all conditions .

    • Strengths: Controls for individual variability; requires fewer total samples .

    • Weaknesses: Potential order effects (can be mitigated through counterbalancing); loss of one sample affects all conditions .

    • Application to lspA research: Useful for time-course studies of lspA expression or testing multiple concentrations of inhibitors on the same bacterial population.

  • Matched Pairs Design:

    • Participants are matched on relevant variables but different participants are used for each condition .

    • Application to lspA research: Could involve matching bacterial strains for specific characteristics before applying different treatments.

For functional studies of recombinant M. leprae lspA, combining these approaches might be optimal. For example, using repeated measures for time-course experiments while employing independent groups for comparing different recombinant constructs or inhibitor treatments.

How can researchers validate the specificity and efficiency of recombinant M. leprae lspA?

Validating the specificity and efficiency of recombinant M. leprae lspA requires multiple complementary approaches:

  • Substrate specificity assessment:

    • Develop a panel of synthetic peptide substrates representing M. leprae prolipoproteins

    • Compare cleavage efficiency across different substrate sequences

    • Analyze the conserved motifs in efficiently processed substrates

    • Test non-lipoprotein signal sequences as negative controls

  • Inhibition profiling:

    • Determine IC50 values for globomycin and other SPase II inhibitors

    • Compare inhibition profiles with other bacterial lspA enzymes

    • Identify potential species-specific differences in inhibitor sensitivity

  • Kinetic characterization:

    • Determine Km and Vmax values for representative substrate peptides

    • Assess the effects of temperature, pH, and ionic conditions on enzyme activity

    • Compare kinetic parameters with those of other bacterial lspA enzymes

  • Genetic complementation quantification:

    • Measure the degree of growth restoration in temperature-sensitive E. coli strains

    • Compare complementation efficiency with that of other bacterial lspA genes

    • Identify factors that influence complementation efficiency

Based on experience with R. typhi lspA, researchers should anticipate potential differences between globomycin binding and prolipoprotein processing activities, as these appear to be somewhat independent cellular functions despite both involving the lspA enzyme .

What approaches can be used to study the expression patterns of M. leprae lspA in different contexts?

Understanding the expression patterns of M. leprae lspA requires specialized techniques given the challenges of working with this obligate intracellular pathogen:

  • Real-time quantitative RT-PCR:

    • This approach has been successfully used to monitor expression of lipoprotein processing genes in R. typhi .

    • Can be applied to different growth phases, infection stages, or in response to various stressors

    • Requires careful selection of reference genes for normalization

    • Should include related genes (lgt, lepB) for comparative analysis

  • Transcriptomic analysis:

    • RNA-seq provides a comprehensive view of gene expression patterns

    • Can reveal co-regulated genes and potential regulatory mechanisms

    • Particularly valuable for identifying condition-specific expression patterns

    • May require host RNA depletion strategies for infected sample analysis

  • Reporter systems:

    • If genetic manipulation is possible, promoter-reporter fusions could be used

    • Alternative approach could involve heterologous expression of the lspA promoter region in model mycobacteria

    • Allows real-time monitoring of expression in various conditions

  • Proteomics approaches:

    • Targeted proteomics (MRM/PRM) for direct quantification of lspA protein levels

    • Global proteomics to correlate lspA expression with other cellular processes

    • Pulse-chase experiments to assess protein turnover rates

For M. leprae research, the limited cultivation options may necessitate working with clinical samples or armadillo-derived material, which presents additional challenges for expression studies.

What are the most promising applications of recombinant M. leprae lspA research?

Research on recombinant M. leprae lspA has several promising applications in both basic science and translational research:

  • Drug development targets:

    • LspA represents a potential target for anti-leprosy therapeutics

    • The essential nature of lipoprotein processing in bacterial viability makes it an attractive intervention point

    • Potential for repurposing existing SPase II inhibitors

    • Opportunity for structure-based drug design approaches

  • Diagnostic applications:

    • Development of functional assays for detecting viable M. leprae in clinical samples

    • Potential serological targets based on lspA-processed lipoproteins

    • Monitoring treatment efficacy through lipoprotein processing activity

  • Vaccine development:

    • Understanding lipoprotein processing may inform subunit vaccine design

    • Processed lipoproteins often serve as important antigens

    • Potential for attenuated strains with modified lipoprotein processing

  • Basic biology insights:

    • Illuminating the specialized adaptations of obligate intracellular pathogens

    • Understanding the evolution of protein secretion pathways

    • Clarifying host-pathogen interactions mediated by bacterial lipoproteins

What are the current limitations in M. leprae lspA research and how might they be addressed?

Several significant challenges currently limit research on M. leprae lspA:

  • Cultivation limitations:

    • M. leprae cannot be cultured in artificial media

    • Current growth systems (mouse footpad, armadillo) are cumbersome and low-yield

    • Potential solution: Development of improved cell culture systems or surrogate mycobacterial hosts

  • Genetic manipulation barriers:

    • Lack of established genetic tools for M. leprae

    • Potential solution: Heterologous expression systems in related mycobacteria; CRISPR-based approaches

  • Structural characterization challenges:

    • Membrane protein crystallization difficulties

    • Potential solution: Cryo-EM approaches; fusion with crystallization chaperones; computational modeling

  • Functional assay limitations:

    • Difficulties in directly measuring lspA activity in M. leprae

    • Potential solution: Development of cell-free assay systems with synthetic substrates; fluorescence-based reporter assays

  • Translational research barriers:

    • Limited animal models that recapitulate human leprosy

    • Ethical considerations in human research

    • Potential solution: Humanized mouse models; organoid-based approaches; improved in vitro systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.