Recombinant Mycobacterium leprae Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Production and Characteristics

The htpX protein is produced via recombinant expression in E. coli with an N-terminal His tag for purification. Key specifications include:

ParameterDetails
Source OrganismMycobacterium leprae (strain Br4923)
Expression HostEscherichia coli
TagN-terminal His tag
Protein LengthFull-length (1-287 amino acids)
Purity>90% (SDS-PAGE confirmed)
FormLyophilized powder or solution in Tris/PBS buffer with trehalose/glycerol
Storage-20°C/-80°C (avoid repeated freeze-thaw cycles)

The protein is reconstituted in deionized water (0.1–1.0 mg/mL) and stabilized with 5–50% glycerol for long-term storage .

Amino Acid Sequence Comparison

SourceSequence Segment
M. leprae MTWHPQANRLKTFVLLVGMSTLIVVVGAIFGRTALFFATLVAVGINVYTYYNSDKLALRA...
M. tuberculosis MTWHPHANRLKTFLLLVGMSALIVAVGALFGRTALMLAALFAVGMNVYVYFNSDKLALRA...

Differences in the N-terminal region (e.g., MTWHPQANRLK vs. MTWHPHANRLK) highlight strain-specific variations .

Vaccine Development

Recombinant htpX is investigated as a potential vaccine candidate for leprosy. Its immunogenicity and role in pathogen-host interactions remain under study, with applications in antigenic profiling and immune response modulation .

Pathogenesis Studies

While not directly studied for htpX, M. leprae proteases like Mce1A are implicated in bacterial entry into respiratory epithelial cells . The htpX homolog may similarly contribute to intracellular survival or evasion of host defenses, though specific mechanisms require further validation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is defined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
htpX; MLBr02278; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Mycobacterium leprae (strain Br4923)
Target Names
htpX
Target Protein Sequence
MTWHPQANRLKTFVLLVGMSTLIVVVGAIFGRTALFFATLVAVGINVYTYYNSDKLALRA MHAQPVSEVQAPVMYRIVRELATGAHQPMPRLYISDTNAPNAFATGRNPRNAAVCCTTGI LEILNERELRAVLGHELSHVYNRDILISCVAGALAGVITALANMAMWAGTFGTTRDEENP FALLLVSLLGPIAATVVRLAVSRSREYQADESGAMLTGDPLALASALRKISSGVQAAPLP PEPQLASQAHLMIANPFRVGDRIGSLFSTHPPIEDRIRRLETMVAGR
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mycobacterium leprae Protease HtpX homolog and what is its biological significance?

Mycobacterium leprae Protease HtpX homolog (htpX) is a zinc metalloproteinase located in the cytoplasmic membrane of M. leprae. It belongs to the M48 family of zinc metalloproteinases and plays a critical role in the quality control of membrane proteins . Based on studies of its homologs in other bacteria such as Escherichia coli, HtpX is involved in eliminating misfolded or misassembled membrane proteins that could potentially compromise membrane integrity and function . For researchers investigating M. leprae pathophysiology, understanding HtpX function provides insights into how this obligate intracellular pathogen maintains membrane homeostasis in the challenging environment of human host cells.

The biological significance of HtpX extends beyond basic protein quality control, as it may contribute to M. leprae's ability to persist within host cells for extended periods, a characteristic feature of leprosy pathogenesis. The protein is encoded in the genome of reference strain Br4923 and consists of 287 amino acids .

What expression systems are most effective for producing recombinant M. leprae HtpX?

For effective recombinant expression of M. leprae HtpX, researchers should consider the following methodological approaches:

The recombinant protein is typically produced with affinity tags (His-tag being common) to facilitate purification . For optimal results, researchers should:

  • Use codon-optimized gene sequences for the selected expression host

  • Test multiple fusion tags and their positions (N- or C-terminal)

  • Screen various induction conditions (temperature, inducer concentration, duration)

  • Employ specialized detergents for extraction and stabilization

Purification typically involves immobilized metal affinity chromatography followed by size-exclusion chromatography in detergent-containing buffers. The purified protein should be stored in a Tris-based buffer with 50% glycerol at -20°C, with working aliquots maintained at 4°C for up to one week .

How can researchers develop an in vivo assay system for M. leprae HtpX protease activity?

  • Construct model substrates: Design fusion proteins containing potential cleavage sites flanked by easily detectable reporter proteins (e.g., fluorescent proteins or epitope tags). Based on E. coli HtpX studies, researchers can create an "HtpX Model Substrate" (XMS) similar to the XMS1 developed for E. coli HtpX .

  • Heterologous expression system: Express both M. leprae HtpX and the model substrate in a suitable host (E. coli, M. smegmatis, or other mycobacteria), preferably under inducible promoters.

  • Detection methods: Employ Western blotting with antibodies against the reporter tags to detect substrate cleavage products. The appearance of cleaved fragments (CL-N and CL-C) indicates protease activity .

  • Quantification: Establish a semiquantitative system by measuring the ratio of full-length substrate to cleaved products using densitometry analysis of Western blot bands.

  • Validation controls: Include protease-dead mutants (with mutations in conserved catalytic residues) and protease inhibitors to confirm specificity.

An example experimental design could include:

ComponentDetails
Model substrateGFP-TM-MBP (GFP fused to transmembrane domain and maltose-binding protein)
Expression systemDual-plasmid E. coli system (one for HtpX, one for substrate)
InductionIPTG-inducible T7 promoter, varied concentrations (0.1-1.0 mM)
DetectionAnti-GFP and anti-MBP antibodies for Western blotting
ControlsHtpX(E140A) catalytically inactive mutant
QuantificationRatio of cleaved product to full-length substrate

This system enables comparative analysis of wild-type HtpX versus mutant variants, assessment of substrate specificity, and screening of potential inhibitors .

What roles does M. leprae HtpX play in the pathogen's survival within host cells?

M. leprae HtpX likely contributes to pathogen survival within host cells through multiple mechanisms:

  • Membrane protein quality control: As a membrane-embedded protease, HtpX helps maintain membrane integrity by eliminating damaged or misfolded membrane proteins. This function is particularly critical in the challenging environment of host cells, where oxidative stress and antimicrobial peptides can damage bacterial membranes .

  • Stress response: In E. coli, HtpX functions as part of the heat shock response system, and a similar role in M. leprae would help the pathogen cope with temperature variations and other stresses encountered during infection .

  • Potential immunomodulation: Proteases from pathogenic bacteria often process surface proteins involved in host-pathogen interactions. HtpX could potentially modify surface proteins to evade immune recognition.

To investigate these roles, researchers can employ:

  • Comparative proteomics: Analyze membrane protein profiles in wild-type versus HtpX-deficient M. leprae (using surrogate systems)

  • Host cell infection models: Utilize armadillo models or macrophage cell lines to compare survival of wild-type and HtpX-mutant strains

  • Stress challenge assays: Expose bacteria to relevant stressors (oxidative stress, nitrosative stress, antimicrobial peptides) and assess survival

The methodological challenges in studying M. leprae functions demand creative approaches, often utilizing surrogate mycobacterial species or heterologous expression systems to model HtpX function.

How does PCR detection of M. leprae DNA relate to studies involving recombinant HtpX protein?

PCR detection of M. leprae DNA and studies involving recombinant HtpX protein represent complementary approaches in leprosy research:

  • Diagnostic versus functional studies: PCR detection primarily serves diagnostic purposes by identifying the RLEP repeat sequence and ITS region specific to M. leprae , while recombinant HtpX studies focus on understanding protein function and potential applications in vaccines or therapeutics.

  • Methodological integration: Researchers can combine these approaches by:

    • Using PCR to confirm M. leprae presence in clinical or experimental samples before proceeding to protein-based studies

    • Employing quantitative PCR to correlate bacterial load with HtpX expression levels

    • Developing PCR assays targeting the htpX gene to study genetic variations across clinical isolates

  • Research limitations: PCR detection has specific limitations researchers should consider:

    • Positive results may indicate passive carriage or non-viable bacilli

    • Dead bacilli can persist for years after treatment, making PCR unsuitable for treatment monitoring

    • Sampling bias can lead to false negatives, especially in paucibacillary specimens

For integrated research protocols, researchers might follow this workflow:

StepTechniquePurpose
1Real-time PCRConfirm M. leprae presence in samples
2RNA extraction and RT-PCRAssess htpX gene expression
3Protein extractionIsolate membrane fraction
4Western blotDetect native HtpX expression
5Recombinant protein studiesFunctional characterization

This integrated approach provides a comprehensive understanding of both the presence of M. leprae and the functional aspects of HtpX protein in research contexts.

How can recombinant M. leprae HtpX be utilized in immunological studies of leprosy?

Recombinant M. leprae HtpX offers valuable applications in immunological studies of leprosy through the following methodological approaches:

  • T cell response profiling: Similar to studies with ML2028 protein , recombinant HtpX can be used to:

    • Stimulate peripheral blood mononuclear cells (PBMCs) from different clinical groups (multibacillary patients, paucibacillary patients, and healthy household contacts)

    • Measure cytokine production using multiplex assays to assess Th1/Th2 polarization

    • Evaluate multifunctional T cell populations through multiparameter flow cytometry

  • Biomarker development: HtpX-specific immune responses may serve as biomarkers for:

    • Disease progression

    • Treatment efficacy monitoring

    • Subclinical infection in high-risk populations

  • Epitope mapping: Researchers can identify immunodominant epitopes within HtpX by:

    • Creating overlapping peptide libraries spanning the entire HtpX sequence

    • Testing epitope-specific T cell responses in different patient groups

    • Correlating epitope recognition patterns with clinical outcomes

A comprehensive immunological study might include:

Patient GroupSample SizeAssaysParameters Measured
Multibacillary (MB)15-20PBMC stimulation with HtpXIFN-γ, IL-2, TNF, IL-10, IL-4
Paucibacillary (PB)30-40Flow cytometryCD4+ multifunctional T cells
Household contacts (HHC)30-40Epitope mappingT cell epitope recognition patterns
Endemic controls20-30Antibody ELISAAnti-HtpX IgG, IgM levels

The comparative analysis between these groups can reveal whether HtpX-specific T cell responses correlate with protection (as suggested for ML2028 ), potentially informing vaccine development strategies.

What substrate specificity determinants govern M. leprae HtpX activity, and how can they be experimentally determined?

Understanding substrate specificity determinants of M. leprae HtpX requires sophisticated experimental approaches:

  • Proteomic identification of natural substrates:

    • Use SILAC (Stable Isotope Labeling with Amino acids in Cell culture) combined with membrane proteomics to compare wild-type versus HtpX-deficient systems

    • Apply Terminal Amine Isotopic Labeling of Substrates (TAILS) to identify proteolytic cleavage sites

    • Confirm direct interactions using co-immunoprecipitation or proximity labeling techniques

  • Synthetic peptide libraries:

    • Design fluorogenic peptide libraries containing systematic variations at positions P4-P4' surrounding potential cleavage sites

    • Measure cleavage efficiency using fluorescence-based assays

    • Derive position-specific scoring matrices for substrate preference

  • Structural biology approaches:

    • Obtain crystal structures of HtpX alone and in complex with substrate mimics or inhibitors

    • Perform molecular docking simulations to predict substrate binding modes

    • Use hydrogen-deuterium exchange mass spectrometry to map conformational changes upon substrate binding

A systematic experimental workflow might include:

PhaseTechniqueExpected Outcome
1Bioinformatic analysisPrediction of potential cleavage motifs based on homology
2Fluorogenic peptide library screeningQuantitative data on position-specific amino acid preferences
3Site-directed mutagenesisIdentification of critical residues in substrate recognition
4Structural studies3D model of substrate-enzyme interactions
5Proteomic validationConfirmation of predicted natural substrates

These approaches will reveal whether M. leprae HtpX exhibits distinct substrate preferences compared to homologs in other bacteria, potentially reflecting unique adaptations to the intracellular lifestyle of this obligate pathogen.

How can researchers address the challenges of studying membrane-bound proteases like HtpX in an uncultivable organism like M. leprae?

Studying membrane-bound proteases like HtpX in the uncultivable M. leprae presents unique methodological challenges that require innovative approaches:

  • Surrogate expression systems:

    • Express M. leprae HtpX in cultivable mycobacteria (M. smegmatis, M. bovis BCG)

    • Create chimeric proteins with domains from cultivable mycobacterial HtpX homologs

    • Develop conditional expression systems in which essential functions in surrogate hosts depend on M. leprae HtpX activity

  • Advanced microscopy techniques:

    • Apply super-resolution microscopy to visualize HtpX localization in infected tissues

    • Use fluorescent activity-based probes to monitor protease activity in situ

    • Implement correlative light and electron microscopy to link protein localization with ultrastructural features

  • Ex vivo systems:

    • Establish primary Schwann cell cultures to mimic the natural host environment

    • Develop organoid models of skin or peripheral nerves for studying HtpX in context

    • Utilize armadillo-derived tissues for ex vivo culture systems

  • Computational approaches:

    • Apply molecular dynamics simulations to predict membrane interactions

    • Use systems biology to integrate transcriptomic, proteomic, and structural data

    • Develop machine learning algorithms to predict substrate-enzyme interactions based on available data

These methodological approaches can be implemented according to the following research progression:

StageApproachKey AdvantagesLimitations
Initial characterizationRecombinant expression and in vitro assaysBiochemical parameter determinationArtificial environment
Functional analysisSurrogate mycobacterial hostsPhysiological membrane contextNot identical to M. leprae
Clinical relevancePatient sample analysisDirect disease relevanceLimited manipulation possibilities
Integrated understandingMulti-omics and computational biologySystems-level insightsRequires validation

By combining these methodologies, researchers can overcome the inherent challenges of studying membrane proteases in M. leprae while gaining meaningful insights into their roles in leprosy pathogenesis.

How can recombinant M. leprae HtpX contribute to vaccine development strategies against leprosy?

Recombinant M. leprae HtpX offers several methodological approaches for leprosy vaccine development:

  • Antigen discovery and characterization:

    • Evaluate HtpX immunogenicity across clinical spectrum (MB, PB, and HHC groups)

    • Determine if HtpX induces protective multifunctional T cell responses similar to ML2028

    • Map immunodominant epitopes that elicit strong Th1-biased responses

  • Subunit vaccine formulation:

    • Incorporate HtpX protein or peptides into adjuvant systems that promote Th1 immunity

    • Develop multi-antigen formulations combining HtpX with other immunogenic proteins

    • Test diverse delivery platforms (protein-adjuvant, viral vectors, DNA vaccines)

  • Preclinical testing strategy:

    • Initial immunogenicity screening in mice and guinea pigs

    • Evaluation in armadillo models for protective efficacy

    • Assessment of safety and immunogenicity in non-human primates

Based on existing research with ML2028 , we can propose the following experimental design for evaluating HtpX as a vaccine candidate:

PhaseExperimental ApproachReadoutsSuccess Criteria
Antigen validationPBMC stimulation from different clinical groupsIFN-γ, IL-2, TNF productionStrong responses in HHC vs. patients
T cell characterizationMultiparameter flow cytometry% multifunctional CD4+ T cellsHigher frequency in protected individuals
Vaccine formulationHtpX + adjuvant combinationsAntibody titers, T cell responsesTh1-biased immunity
Challenge studiesArmadillo infection modelBacterial burden, histopathologyReduction in bacterial load

The multifunctional T cell response pattern observed in household contacts but diminished in patients suggests that maintaining such responses could be protective against disease progression, making proteins that elicit these responses promising vaccine candidates.

What strategies can researchers employ to identify inhibitors of M. leprae HtpX for potential therapeutic applications?

Identifying inhibitors of M. leprae HtpX requires a methodical approach spanning computational, biochemical, and cellular techniques:

  • In silico screening approaches:

    • Homology modeling of M. leprae HtpX based on crystallized homologs

    • Virtual screening of compound libraries targeting the active site

    • Molecular dynamics simulations to evaluate binding stability

    • Fragment-based drug design to develop novel scaffolds

  • Biochemical screening platforms:

    • Develop high-throughput fluorescence resonance energy transfer (FRET) assays using synthetic peptide substrates

    • Design activity-based probes that covalently modify the active site

    • Implement thermal shift assays to identify compounds that stabilize HtpX structure

  • Cellular validation systems:

    • Test candidate inhibitors in surrogate mycobacterial expression systems

    • Evaluate effects on M. leprae viability in mouse footpad models

    • Assess toxicity against human cells to establish therapeutic windows

A comprehensive inhibitor discovery campaign might include:

StageMethodScaleOutcome Measures
Primary screenVirtual screening10⁶ compoundsDocking scores, binding energy
Secondary screenFRET-based enzyme assay10³ compoundsIC₅₀ values, inhibition kinetics
Tertiary screenSurrogate mycobacterial growth10² compoundsMIC values, killing curves
Lead optimizationMedicinal chemistry10-20 compoundsStructure-activity relationships
Preclinical testingMouse footpad model3-5 compoundsIn vivo efficacy, pharmacokinetics

Given the essential role of membrane protein quality control in bacterial survival, HtpX inhibitors could represent a novel class of antimycobacterial agents with potential applications in leprosy treatment, particularly for drug-resistant cases.

How can structural studies of recombinant M. leprae HtpX advance our understanding of protease inhibition mechanisms?

Structural studies of recombinant M. leprae HtpX can significantly advance protease inhibition understanding through these methodological approaches:

  • Protein crystallography pipeline:

    • Optimize protein construct design to remove flexible regions while preserving catalytic domains

    • Screen detergent and lipid conditions that maintain stability during crystallization

    • Implement lipidic cubic phase crystallization for membrane protein structure determination

    • Co-crystallize with substrate peptides or inhibitors to capture different functional states

  • Cryo-electron microscopy (cryo-EM) approaches:

    • Apply single-particle cryo-EM for high-resolution structure determination

    • Use cryo-electron tomography to visualize HtpX in its native membrane environment

    • Implement focused classification to resolve conformational heterogeneity

  • Integrated structural biology techniques:

    • Combine X-ray crystallography with small-angle X-ray scattering (SAXS) for solution dynamics

    • Apply hydrogen-deuterium exchange mass spectrometry to map conformational changes

    • Utilize solid-state NMR for studying membrane-embedded regions

A comprehensive structural biology workflow would include:

The structural insights gained would enable:

  • Identification of unique structural features distinguishing M. leprae HtpX from human proteases

  • Design of selective inhibitors targeting M. leprae-specific binding pockets

  • Understanding of substrate recognition mechanisms

  • Elucidation of the catalytic mechanism at atomic resolution

These advances would facilitate structure-based drug design approaches and potentially lead to novel therapeutic strategies for leprosy treatment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.