Recombinant Mycobacterium leprae UPF0353 protein MLBr01808 (MLBr01808) is a protein derived from Mycobacterium leprae, specifically strain Br4923 . It is also referred to as UPF0353 protein mLBr01808 . The protein is a recombinant protein, implying it is produced using genetic engineering techniques .
The protein consists of 335 amino acids . The amino acid sequence is:
MTLPLLGPMSLSGFEHSWFFLFIFIVFGLAAFYVMMQVARQRRmLRFANMELLESVAPNR
PVQWRHVPAILLmLALLLFTIAMAGPTNDVRIPRNRAVVmLVIDVSQSMRATDVEPNRMA
AAQEAAKQFAGELTPGINLGLIAYAGTATVLVSPTTNRYATKNALDKLQFADRTATGEAI
FTALQAIATVGAVIGGGEMPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPIS
TISFGTVYGFVEINGQRQPVPVDDETMKKVAQLSGGNSYNAATLAELKAVYASLQQQIGY
ETIKGDASAGWLRLGVLVLALAALTALLINRRLPT
M. leprae proteins can serve as biomarkers, and research has been done employing proteomic approaches to study M. leprae .
ML-LBP21 is a 21-kDa surface protein of Mycobacterium leprae that binds peripheral nerve laminin-2 . It is a major surface protein of M. leprae and is involved in Schwann cell invasion via a laminin-2-dependent pathway .
Numerous antigens of M. leprae have been tested for diagnostic feasibility, but their use has been limited due to their poor performance .
KEGG: mlb:MLBr01808
MLBr01808 is a UPF0353 family protein from Mycobacterium leprae (strain Br4923) with 335 amino acids. Its amino acid sequence (MTLPLLGPMSLSGFEHSWFFLFIFIVFGLAAFYVMMQVARQRRMLRFANMELLESVAPNRPVQWRHVPAILLMLALLLFTIAMAGPTNDVRIPRNRAVVMLVIDVSQSMRATDVEPNRMAAAQEAAKQFAGELTPGINLGLIAYAGTATVLVSPTTNRYATKNALDKLQFADRTATGEAIFTALQAIATVGAVIGGGEMPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPISTISFGTVYGFVEINGQRQPVPVDDETMKKVAQLSGGNSYNAATLAELKAVYASLQQQIGYETIKGDASAGWLRLGVLVLALAALTALLINRRLPT) contains multiple hydrophobic regions suggesting it may be a membrane-associated protein . It has a UniProt ID of B8ZS82 and appears to be conserved within mycobacterial species. While the specific function remains under investigation, the UPF0353 designation indicates it belongs to a protein family with currently uncharacterized function .
Recombinant MLBr01808 is commonly expressed in E. coli expression systems, though yeast-based expression is also utilized for specific applications . The protein is typically tagged with a histidine tag (His-tag) at the N-terminus to facilitate purification through immobilized metal affinity chromatography (IMAC) . The purified protein generally achieves >85-90% purity as determined by SDS-PAGE analysis . The protein can be delivered in lyophilized form or in solution with specific buffer conditions (usually Tris-based buffers with glycerol or trehalose as stabilizers) . When working with this protein, it's advisable to avoid repeated freeze-thaw cycles as they may impact protein stability and activity .
For long-term storage, recombinant MLBr01808 should be kept at -20°C to -80°C, with the latter preferred for extended periods . The protein should be stored in appropriate buffer conditions, typically Tris/PBS-based buffers containing stabilizers like trehalose (6%) or glycerol (recommended at 5-50%, with 50% being optimal) . For lyophilized forms, the shelf life is approximately 12 months at -20°C/-80°C, while liquid preparations typically have a 6-month shelf life under similar storage conditions . Working aliquots can be stored at 4°C for up to one week . To minimize protein degradation, it's critical to avoid repeated freeze-thaw cycles; therefore, preparing small single-use aliquots upon initial reconstitution is recommended .
For optimal reconstitution of lyophilized MLBr01808, the vial should first be briefly centrifuged to bring all content to the bottom . The protein should then be reconstituted in deionized sterile water to achieve a final concentration of 0.1-1.0 mg/mL . Addition of glycerol to a final concentration of 5-50% is recommended for stability, with 50% being commonly used . After reconstitution, the solution should be gently mixed until completely dissolved, avoiding vigorous vortexing which could lead to protein denaturation. The reconstituted protein should be immediately aliquoted into single-use volumes and stored at -20°C or -80°C to prevent degradation from repeated freeze-thaw cycles .
The function of MLBr01808 is not fully characterized, as indicated by its UPF0353 (Uncharacterized Protein Family 0353) designation . Based on its amino acid sequence containing multiple hydrophobic regions, it is likely a membrane-associated protein that may play a role in cell envelope integrity or transport processes . The protein appears to be conserved within mycobacterial species, suggesting it might serve an important function for mycobacterial survival or pathogenesis. Unlike some other M. leprae proteins such as ML2028 (which has been studied for immune responses), MLBr01808's role in immune recognition or pathogen-host interactions remains to be established . Comparative genomic analyses with homologous proteins in other mycobacteria might provide insights into its potential function, particularly when combined with structural predictions and interaction studies.
MLBr01808 can be utilized in various immunological investigations related to leprosy research. Similar to other recombinant M. leprae proteins like ML2028, it can be employed in T-cell stimulation assays to assess antigen-specific immune responses in different patient populations . Whole blood assays and peripheral blood mononuclear cell (PBMC) cultures can be set up with the recombinant protein to analyze cytokine production patterns (particularly IFN-γ, IL-2, and TNF) and identify multifunctional T cells responding to this antigen . Comparing responses between paucibacillary (PB) patients, multibacillary (MB) patients, and healthy household contacts (HHC) may reveal whether MLBr01808 elicits protective immunity or contributes to immunopathogenesis . Additionally, antibody responses against this protein could be measured to assess its potential as a serological marker for infection or disease progression.
Several complementary approaches can be employed to investigate MLBr01808's protein-protein interactions. Co-immunoprecipitation (Co-IP) using anti-tag antibodies (against the His-tag) can pull down MLBr01808 along with its binding partners from mycobacterial lysates or from systems where it's co-expressed with other mycobacterial proteins . Yeast two-hybrid screening can identify potential interacting partners when using MLBr01808 as bait against a M. leprae genomic library . Pull-down assays using the recombinant protein can capture interacting proteins from bacterial or host cell lysates. Protein crosslinking followed by mass spectrometry can identify proteins in close proximity to MLBr01808 in its native environment. Bacterial two-hybrid systems may be particularly useful for membrane-associated proteins like MLBr01808. Surface plasmon resonance (SPR) can determine binding affinities with candidate interacting proteins. These approaches should be complemented with appropriate controls and validation studies using techniques like FRET or BiFC to confirm interactions in more native-like contexts.
Structural characterization of membrane-associated proteins like MLBr01808 presents unique challenges requiring specialized approaches. X-ray crystallography would require protein purification in detergent micelles or nanodiscs to maintain proper folding, followed by crystallization trials using membrane protein-specific screens . Cryo-electron microscopy (cryo-EM) offers an alternative approach that may require less protein and can visualize the protein in a more native-like environment. Nuclear Magnetic Resonance (NMR) spectroscopy could be employed for structural determination of specific domains, particularly if they can be expressed separately from the transmembrane regions. Computational approaches including homology modeling based on structurally characterized UPF0353 family members, along with molecular dynamics simulations, can provide preliminary structural insights. For membrane topology analysis, techniques such as site-directed fluorescence labeling, cysteine accessibility methods, or protease protection assays can determine which regions are exposed to different cellular compartments. Circular dichroism spectroscopy can provide information about secondary structure composition.
Investigating MLBr01808's role in M. leprae pathogenesis requires creative approaches due to the uncultivable nature of this pathogen. Heterologous expression in culturable mycobacteria (like M. smegmatis or attenuated M. tuberculosis) followed by phenotypic analysis can reveal functional implications . Gene silencing using antisense RNA or CRISPR interference in surrogate mycobacterial hosts expressing MLBr01808 could provide loss-of-function insights. Conditional expression systems can help study essential proteins whose complete deletion might be lethal. The mouse footpad model or armadillo infection model could be used to assess the impact of antibodies against MLBr01808 on infection progression. Comparative genomics and transcriptomics across different M. leprae strains and closely related mycobacteria can highlight correlations between MLBr01808 sequence variations and pathogenic potential. Host-pathogen interaction studies using recombinant MLBr01808 with human cells can reveal potential interactions with host receptors or immune components . Computational prediction of epitopes combined with experimental validation can assess immunogenicity and potential as a vaccine candidate.
Evaluating MLBr01808 as a diagnostic marker begins with serological studies comparing antibody responses against the recombinant protein in leprosy patients (both PB and MB forms), household contacts, tuberculosis patients, and endemic controls . ELISA, lateral flow assays, or multiplex bead-based immunoassays can be developed to detect antibodies against MLBr01808 with assessment of sensitivity, specificity, and predictive values. T-cell-based diagnostic approaches using MLBr01808 as a stimulating antigen in interferon-gamma release assays (similar to those used for TB diagnosis) could be developed . For vaccine potential assessment, animal models (including mouse footpad or armadillo models) can evaluate protective efficacy when immunized with MLBr01808 alone or as part of subunit vaccine formulations. Immune correlates of protection should be identified through comprehensive immunological profiling, focusing particularly on multifunctional T cell responses similar to those observed with other protective antigens like ML2028 . Structural mapping of B-cell and T-cell epitopes can guide rational design of improved vaccine constructs. Population-based immunogenetic studies can identify potential MHC-restricted responses to optimize coverage across diverse human populations.
Several challenges may arise when working with recombinant MLBr01808. Protein solubility issues due to its hydrophobic regions can be addressed by optimizing expression conditions (lower temperature, specific E. coli strains) or using solubility-enhancing tags beyond the His-tag . Protein aggregation during storage can be minimized by adding appropriate stabilizers like trehalose (6%) or glycerol (50%) to storage buffers and avoiding repeated freeze-thaw cycles . Protein functionality assessment is challenging for proteins with unknown function; activity assays should be developed based on predicted functions or by comparing properties with homologous proteins of known function. Endotoxin contamination from E. coli expression systems can interfere with immunological assays; endotoxin removal techniques (polymyxin B columns, Triton X-114 phase separation) should be applied before using the protein in such studies . Protein degradation during purification can be minimized by including protease inhibitors and performing all steps at 4°C. Non-specific binding in interaction studies can be controlled using appropriate blocking agents and stringent washing conditions.
Ensuring reproducibility in immunological experiments with MLBr01808 requires systematic attention to multiple factors. Protein quality control should be rigorously performed for each lot, including purity assessment (SDS-PAGE, mass spectrometry), endotoxin testing, and functional validation . Standardized protocols for protein handling, storage, and reconstitution should be established and meticulously followed . When working with human samples, standardization of collection, processing, and storage methods is crucial, along with detailed documentation of patient demographics, disease classification, and treatment status . Appropriate positive and negative controls should be included in each experiment, such as known M. leprae antigens (ML2028) and irrelevant proteins expressed under identical conditions . Multiple technical and biological replicates should be performed to account for variability. Comprehensive reporting of experimental conditions, including protein concentration, incubation times, temperatures, and buffer compositions, is essential. Statistical analysis methods should be pre-defined and appropriate for the experimental design. Validation of key findings using alternative experimental approaches or independent sample cohorts increases confidence in results.
Investigating post-translational modifications (PTMs) of native MLBr01808 requires specialized approaches given the challenges of working with M. leprae. Mass spectrometry-based proteomic analysis of M. leprae proteins extracted from experimental models (mouse footpad, armadillo tissues) can identify PTMs through comparison with theoretical mass profiles of unmodified proteins. Phosphorylation can be detected using phospho-specific antibodies or phosphoprotein-specific staining methods. Glycosylation can be assessed using glycan-specific stains (PAS staining), lectin blotting, or mass spectrometry after glycan release. Comparing electrophoretic mobility of native protein (from M. leprae extracts) with recombinant protein expressed in E. coli (which may lack certain PTMs) can suggest the presence of modifications. Site-directed mutagenesis of predicted modification sites followed by functional analysis can determine the importance of specific PTMs. Antibodies generated against synthetic peptides containing predicted PTMs can be used to specifically detect modified forms of MLBr01808. Computational prediction tools can identify potential PTM sites to guide experimental investigations, with particular attention to mycobacteria-specific modifications like mycothiolation or ADP-ribosylation.
Multi-omics approaches offer powerful strategies to comprehensively investigate MLBr01808's biological significance. Comparative genomics across multiple M. leprae strains and related mycobacteria can identify sequence conservation patterns and genetic linkage with other virulence factors. Transcriptomics can determine when and under what conditions MLBr01808 is expressed, potentially correlating with specific growth phases or stress responses. Proteomics approaches like protein-protein interaction mapping through proximity labeling or co-immunoprecipitation coupled with mass spectrometry can identify the protein's interaction network . Metabolomics comparison between wild-type and MLBr01808-deficient surrogate mycobacterial hosts might reveal metabolic pathways affected by the protein. Structural biology approaches including cryo-EM or NMR can elucidate functional domains. Immunopeptidomics can identify which MLBr01808 peptides are presented by MHC molecules, informing vaccine design. Systems biology integration of these multi-omics datasets can generate testable hypotheses about MLBr01808's function and its relationship to M. leprae pathogenesis. Machine learning approaches applied to these integrated datasets may uncover non-obvious patterns and relationships.
Effective investigation of MLBr01808 would benefit from multidisciplinary collaborative frameworks bringing together complementary expertise. International consortia connecting researchers from leprosy-endemic regions with those having advanced technological capabilities can facilitate sample sharing and knowledge transfer. Collaborative networks linking structural biologists, immunologists, and microbiologists would enable comprehensive functional characterization . Partnerships between academic laboratories and clinical centers treating leprosy patients provide access to well-characterized clinical samples for immunological studies. Public-private partnerships with pharmaceutical or biotechnology companies could accelerate translation of findings into diagnostic or therapeutic applications. Open-science initiatives promoting data sharing, method standardization, and collaborative analysis would maximize research impact. Engagement with funding agencies and policy makers from leprosy-endemic countries ensures research relevance to affected populations. Training programs for early-career scientists from endemic regions builds sustainable research capacity. Community engagement involving affected populations in research planning ensures ethical practices and helps disseminate findings to those who would benefit most.
Research on MLBr01808 can provide valuable insights extending beyond leprosy to mycobacterial pathogenesis generally. Comparative studies of UPF0353 family proteins across pathogenic and non-pathogenic mycobacteria (including M. tuberculosis) can identify conserved functions potentially crucial for mycobacterial survival . Understanding membrane-associated proteins like MLBr01808 may reveal novel drug targets applicable to multiple mycobacterial diseases, particularly important given increasing antimicrobial resistance. Immunological studies of MLBr01808 can contribute to understanding how mycobacteria interact with the human immune system, potentially revealing mechanisms of immune evasion common across species . Methodological advances in working with difficult-to-express mycobacterial membrane proteins can benefit tuberculosis research and other infectious disease fields. Novel diagnostic approaches developed for MLBr01808 might be applicable to other mycobacterial infections with appropriate modifications. Understanding the structure-function relationship of this protein family may reveal previously uncharacterized biological processes in mycobacteria. Finally, insights from host-pathogen interactions involving MLBr01808 may elucidate general principles of how chronic bacterial pathogens establish long-term infection.