Recombinant Mycobacterium marinum ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
atpF; MMAR_4091; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Mycobacterium marinum (strain ATCC BAA-535 / M)
Target Names
atpF
Target Protein Sequence
MDDVNSIVLAAGQAAEEGGTNNFLVPNGTFFFVLAIFLVVLAVIGTFVVPPILKVLRERD AMVAKTLADNKKSAEQFAAAQADYEKAMAEARVQASSYRDNARAEGRKVVEDARAHAEQE VASTLQQANEQLKRERDAVELDLRANVGAMSATLANRIVGVDVTTPAAAG
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core; and the F0 domain, containing the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the molecular function of ATP synthase subunit b (atpF) in Mycobacterium marinum?

ATP synthase subunit b functions as a critical component of the F0 portion of the ATP synthase complex, forming part of the peripheral stalk that connects the membrane-embedded F0 sector to the catalytic F1 sector. In mycobacteria like M. marinum, this protein likely plays several essential roles:

  • Maintaining structural stability of the ATP synthase complex

  • Participating in proton translocation across the membrane

  • Facilitating the conformational changes necessary for ATP synthesis

  • Contributing to the adaptation of energy metabolism during different growth phases

For researchers studying this protein, it's important to recognize that ATP synthesis is particularly crucial during M. marinum's intracellular lifestyle phases, including when the bacterium escapes from phagosomes and employs actin-based motility for cell-to-cell spread . The energy requirements for these processes suggest that atpF and the ATP synthase complex could be critical virulence determinants.

What expression systems are most effective for producing recombinant M. marinum atpF?

For optimal expression of recombinant M. marinum atpF, researchers should consider the following methodological approach:

  • Vector selection: pET expression systems using T7 promoters provide tight regulation and high expression levels

  • Host selection: E. coli BL21(DE3) strains are recommended for membrane protein expression

  • Growth conditions: Lower temperatures (16-25°C) after induction help prevent inclusion body formation

  • Fusion tags: N-terminal His6 or GST tags facilitate purification while minimizing interference with function

  • Solubilization: Non-ionic detergents like DDM or LDAO effectively solubilize membrane proteins

Expression protocols should include optimization steps for induction timing, temperature, and inducer concentration. For challenging expression projects, consider co-expression with chaperones or expression as part of a larger ATP synthase subcomplex to improve stability and solubility.

How can researchers verify the correct folding and activity of recombinant atpF protein?

Verification of properly folded and functional recombinant atpF requires multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Size exclusion chromatography to verify oligomeric state

  • Limited proteolysis to evaluate structural integrity

  • Thermal shift assays to determine protein stability

  • Reconstitution assays with other ATP synthase subunits to test complex formation

  • Binding assays with known interacting partners (other ATP synthase subunits)

For functional activity, researchers should develop reconstitution systems incorporating recombinant atpF with other ATP synthase subunits in liposomes, followed by ATP synthesis/hydrolysis assays. When expressing membrane proteins like atpF from M. marinum, it's critical to maintain native-like membrane environments during purification and activity measurements.

What cell and animal models are appropriate for studying M. marinum atpF function?

Several experimental models can be employed to study M. marinum atpF function in relevant biological contexts:

  • Macrophage cell lines: J774 A.1, RAW 264.7, and fish macrophage cell line CLC have been successfully used for M. marinum infection studies

  • Amoeba model: Dictyostelium discoideum serves as an excellent host for studying M. marinum pathogenesis

  • Zebrafish (Danio rerio): Natural host for M. marinum providing optical transparency for in vivo imaging

  • Mouse footpad model: Allows for bioluminescent imaging of M. marinum infection progression

When designing experiments using these models, researchers should consider generating conditional atpF mutants or employing inducible expression systems, as complete deletion of essential genes like atpF may not be viable. The mouse footpad model with bioluminescent M. marinum strains enables non-invasive monitoring of infection progression and response to treatments .

How does atpF contribute to M. marinum's ability to escape phagosomes?

M. marinum demonstrates the remarkable ability to escape from phagosomes in infected macrophages, a process that distinguishes it from many other mycobacterial species . While the direct role of atpF in this process hasn't been fully characterized, researchers should consider these methodological approaches:

  • Generate conditional atpF knockdown strains using inducible systems

  • Employ fluorescence microscopy with markers for phagosomes and cytosol

  • Use electron microscopy to visualize phagosomal membranes around bacteria

  • Track bacterial co-localization with phagosomal markers over time

  • Compare escape efficiency between wild-type and atpF-depleted strains

M. marinum's escape from phagosomes enables it to polymerize actin and spread directly from cell to cell . The energy requirements for these processes suggest that ATP synthase activity, including the contribution of atpF, may be critical for this aspect of M. marinum pathogenesis.

How can genome-wide fitness analysis be applied to understand atpF essentiality in M. marinum?

Genome-wide fitness analysis using transposon mutagenesis provides powerful insights into gene essentiality under different conditions. For atpF research, consider this methodological framework:

  • Generate a saturated transposon library using MycoMarT7 vector with Himar1 transposon, inserting at TA dinucleotides throughout the genome

  • Subject the library to selection in various conditions (in vitro growth, macrophage infection, animal infection)

  • Use next-generation sequencing to identify insertions and their frequencies

  • Apply computational tools like TRANSIT to analyze insertion patterns and determine gene essentiality

  • Compare atpF insertion patterns to other ATP synthase components

The M. marinum genome contains 102,057 TA sites that could theoretically support transposon insertion, with insertions observed in approximately 57% of these sites in experimental libraries . Analysis should account for low-permissive sequences with consensus "(GC)GNTANC(GC)" that resist insertion . By examining conditional essentiality of atpF across different growth conditions, researchers can identify contexts where ATP synthase function is most critical.

What mechanisms link atpF function to M. marinum's actin-based motility?

M. marinum uniquely exploits host actin cytoskeleton for cell-to-cell spread, similar to pathogens like Listeria, Shigella, and Rickettsia . Investigating the relationship between atpF function and actin-based motility requires sophisticated experimental approaches:

  • Generate fluorescently tagged actin and atpF to visualize their distribution during infection

  • Employ time-lapse microscopy to track bacterial movement in real-time

  • Conduct immunofluorescence to detect key cytoskeletal proteins: Arp2/3 complex, vasodilator-stimulated phosphoprotein (VASP), and Wiskott-Aldrich syndrome protein (WASP)

  • Modulate ATP synthase activity using genetic approaches or specific inhibitors

  • Quantify actin tail formation efficiency and bacterial movement speed under different energetic states

Research has shown that M. marinum can recruit host cytoskeletal proteins to polymerize actin, with WASP localizing exclusively at the actin-polymerizing pole of the bacterium . The energy requirements for this process suggest that ATP synthase components like atpF may play critical roles in supporting these energy-intensive virulence mechanisms.

How can structural biology approaches inform atpF-targeted antimicrobial development?

Structural characterization of M. marinum atpF could accelerate drug discovery efforts targeting mycobacterial ATP synthase:

  • Express and purify recombinant atpF in sufficient quantities for structural studies

  • Employ X-ray crystallography or cryo-electron microscopy to determine high-resolution structures

  • Identify potential druggable pockets using computational analysis

  • Conduct virtual screening of compound libraries against identified binding sites

  • Validate hits using biophysical binding assays and functional inhibition tests

  • Evaluate promising compounds using the in vivo imaging model with bioluminescent M. marinum

Researchers should focus on structural features that differentiate mycobacterial atpF from host ATP synthase components to maximize therapeutic potential while minimizing toxicity. The recent development of non-invasive in vivo imaging methods for assessing antimicrobial efficacy against M. marinum infection provides an excellent platform for evaluating the therapeutic potential of atpF-targeting compounds.

What role does atpF play in M. marinum adaptation to different infection microenvironments?

Understanding how atpF contributes to M. marinum adaptation across different infection niches requires sophisticated experimental designs:

  • Generate reporter strains with fluorescent or bioluminescent markers linked to atpF expression

  • Track expression levels during infection progression using in vivo imaging

  • Isolate bacteria from different microenvironments (early phagosomes, cytosol, granulomas)

  • Compare transcriptomic and proteomic profiles across these environments

  • Develop conditional expression systems to modulate atpF levels at specific infection stages

M. marinum infection progresses through distinct phases, including granuloma formation with necrotic abscesses primarily involving neutrophils . ATP synthase activity likely varies across these phases to meet changing energy demands. The temporal progression of infection, with footpad swelling peaking around 14 days post-infection and significant cytokine/chemokine responses by day 7 , provides a framework for studying atpF contribution throughout infection.

How can recombinant atpF be utilized in developing diagnostic tools for mycobacterial infections?

Recombinant M. marinum atpF could serve as a foundation for novel diagnostic approaches:

  • Express and purify highly antigenic regions of atpF

  • Develop antibody-based detection systems (ELISA, lateral flow assays)

  • Create aptamer-based biosensors targeting atpF or related ATP synthase components

  • Design nucleic acid amplification tests targeting atpF gene sequences

  • Evaluate cross-reactivity with other mycobacterial species, particularly M. tuberculosis

  • Validate diagnostic performance using clinical samples

When developing these diagnostic tools, researchers should consider the conservation of atpF across mycobacterial species and the potential for cross-reactivity. The similarity between M. marinum and M. tuberculosis provides an opportunity to develop diagnostic platforms relevant to human tuberculosis using the more tractable M. marinum model.

What experimental approaches can determine if atpF interacts with host cellular components during infection?

Investigating potential interactions between mycobacterial atpF and host factors requires multidisciplinary approaches:

  • Perform pull-down assays using tagged recombinant atpF and host cell lysates

  • Conduct yeast two-hybrid or bacterial two-hybrid screens

  • Employ proximity labeling techniques (BioID, APEX) during infection

  • Utilize fluorescence resonance energy transfer (FRET) to detect direct interactions

  • Develop split reporter systems to visualize protein-protein interactions in real-time

M. marinum's ability to interact with host cytoskeletal components during actin-based motility suggests possible direct or indirect interactions between bacterial and host proteins. Understanding whether atpF participates in these interactions could reveal novel aspects of host-pathogen biology. Researchers should consider both membrane-associated and cytosolic host proteins as potential interaction partners.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.