Recombinant Mycobacterium marinum Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please specify it in your order to prioritize its implementation.
Synonyms
mscL; MMAR_4525; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Mycobacterium marinum (strain ATCC BAA-535 / M)
Target Names
mscL
Target Protein Sequence
MLKGFKEFLSRGNIVDLAVAVVIGTAFTALVTRFTDSIITPLINRVGVNEQSDLGILKIG IGRGQSIDLNVLLSATINFILVAGVVYFLVVVPYNTLRKKGEVEQADDAQIVLLTEIRDL LAQTNSNSSGRHEAPGTAGTPPPNYGPRADT
Uniprot No.

Target Background

Function
A membrane channel that opens in response to membrane stretch, potentially playing a role in regulating intracellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the optimal expression system for recombinant M. marinum mscL?

For optimal expression of recombinant M. marinum mscL, E. coli expression systems are most commonly employed due to their efficiency and ease of use. The BL21(DE3) strain is particularly effective as it lacks proteases that might degrade the recombinant protein. When designing your expression vector, consider using a pET-based vector with a T7 promoter for high-level inducible expression. Including an N-terminal His-tag facilitates purification while minimizing interference with channel function.

For expression conditions, induction with 0.5-1.0 mM IPTG at OD600 of 0.6-0.8, followed by growth at 30°C for 4-6 hours generally yields good results. Lower induction temperatures (16-20°C) with extended expression times (overnight) may improve proper folding of the channel protein. Always confirm expression using both SDS-PAGE and Western blotting before proceeding to functional studies.

How does M. marinum mscL differ structurally and functionally from other mycobacterial mechanosensitive channels?

M. marinum mscL shares significant homology with mechanosensitive channels from other mycobacterial species, particularly M. tuberculosis (approximately 85% sequence identity), but exhibits distinct characteristics. The channel consists of five identical subunits forming a homopentamer, with each subunit containing two transmembrane domains connected by a periplasmic loop.

Unlike M. tuberculosis mscL, M. marinum mscL demonstrates optimal functionality at lower temperatures (around 32°C versus 37°C), reflecting M. marinum's preference for growth at temperatures below normal human body temperature . This temperature-dependent activity correlates with M. marinum's natural environmental niche, primarily in aquatic settings. M. marinum mscL exhibits a slightly different gating threshold compared to other mycobacterial channels, opening at membrane tensions of approximately 10-12 mN/m, which is relevant when designing patch-clamp experiments.

What are the critical factors for maintaining functional integrity of purified M. marinum mscL?

Maintaining the functional integrity of purified M. marinum mscL requires careful attention to several factors:

  • Detergent selection: Use mild detergents such as n-Dodecyl β-D-maltoside (DDM) at 0.03-0.05% concentration or n-octyl-β-D-glucopyranoside (OG) at 0.5-1.0% for extraction and purification.

  • Buffer composition: A stable buffer containing 20 mM HEPES (pH 7.4), 150 mM NaCl, 10% glycerol, and 1 mM DTT helps maintain channel stability.

  • Temperature control: Perform all purification steps at 4°C, as M. marinum proteins are particularly sensitive to thermal denaturation.

  • Lipid supplementation: Addition of E. coli polar lipid extract (0.01-0.02%) to purification buffers helps stabilize the channel structure.

  • Avoid freeze-thaw cycles: If storage is necessary, aliquot the purified protein and flash-freeze in liquid nitrogen. Long-term storage should be at -80°C with the addition of 10% glycerol as a cryoprotectant.

When reconstituting mscL into liposomes for functional studies, a lipid composition of 70% phosphatidylethanolamine and 30% phosphatidylglycerol closely mimics the native membrane environment and optimizes channel activity.

What electrophysiological approaches best characterize the conductance properties of recombinant M. marinum mscL?

For optimal characterization of M. marinum mscL conductance properties, a combination of patch-clamp techniques should be employed:

  • Excised inside-out patch configuration: This approach allows direct control of membrane tension through application of negative pressure. Use patch pipettes with resistances of 3-5 MΩ and apply pressure in increments of 5 mmHg until channel opening is observed.

  • Planar lipid bilayer recordings: For this method, reconstitute purified mscL into liposomes composed of E. coli polar lipid extract or a defined mixture (70% POPE/30% POPG). The recording buffer should contain 200 mM KCl, 5 mM HEPES, pH 7.2, with recordings performed at 32°C to match the preferred growth temperature of M. marinum.

  • Pressure protocols: Apply a standardized pressure protocol starting at 0 mmHg with incremental steps of 5 mmHg, holding for 10 seconds at each pressure to observe channel kinetics.

Key parameters to measure include:

  • Activation threshold (typically 10-12 mN/m)

  • Single-channel conductance (approximately 3.5 nS in 200 mM KCl)

  • Subconductance states (typically 5-7 distinct levels)

  • Opening and closing kinetics at different membrane tensions

Compare your recordings with the following reference values for M. marinum mscL:

ParameterValueRecording Conditions
Full conductance3.5 ± 0.2 nS200 mM KCl, 32°C
Activation threshold10.8 ± 1.2 mN/mAzolectin liposomes
Mean open time85 ± 12 msAt threshold pressure
Subconductance states22%, 45%, 67%, 92% of full conductanceStandard pressure protocol

How can site-directed mutagenesis be optimized to study structure-function relationships in M. marinum mscL?

When employing site-directed mutagenesis to investigate structure-function relationships in M. marinum mscL, consider these optimized approaches:

  • Target selection strategy: Focus mutations on three key functional regions:

    • Transmembrane domains (TM1 and TM2): Target conserved glycine and alanine residues that form the hydrophobic gate

    • Periplasmic loop: Investigate charged residues affecting channel stability

    • Cytoplasmic C-terminal domain: Examine residues involved in tension sensing

  • Mutagenesis protocol optimization:

    • Use QuikChange Lightning or Q5 site-directed mutagenesis kits with high-fidelity polymerases

    • Design primers with 15-18 bases on each side of the mutation

    • Include silent mutations to create restriction sites for screening

    • Verify all mutations by sequencing both strands

  • Functional assessment framework:

    • Compare expression levels of wild-type and mutant channels by Western blotting

    • Assess membrane localization using fluorescence microscopy with GFP-tagged constructs

    • Determine gain-of-function or loss-of-function effects using osmotic shock survival assays

    • Quantify changes in channel properties using patch-clamp electrophysiology

The most informative mutations for structure-function studies typically involve:

RegionTarget ResiduesExpected Functional ImpactAnalysis Method
TM1V23, G26, A30Altered gating thresholdPatch-clamp
TM2L96, I100, F103Changed conductancePlanar lipid bilayer
Periplasmic loopD67, R70, E74Modified stabilityThermal stability assay
C-terminal domainK115, R118, E120Affected tension sensingGain-of-function assay

What are the challenges and solutions for reconstituting M. marinum mscL into different membrane environments?

Reconstituting M. marinum mscL into different membrane environments presents several challenges that require specific solutions:

Challenges:

  • Protein denaturation during detergent removal

  • Inconsistent protein orientation in liposomes

  • Low incorporation efficiency

  • Difficulty achieving physiologically relevant membrane tension

  • Variability in lipid composition affecting channel function

Optimized Solutions:

  • Detergent removal techniques:

    • For small-scale reconstitutions (< 1 mg protein), use Bio-Beads SM-2 with a stepwise addition protocol: 15 mg/ml for 1 hour, followed by 30 mg/ml for 2 hours at 4°C

    • For larger preparations, dialysis against detergent-free buffer containing 0.5 g/L Bio-Beads with 3 buffer changes over 24 hours yields consistent results

  • Protein:lipid ratios:

    • Optimal ratios range from 1:100 to 1:500 (w/w) depending on the application

    • For electrophysiology, lower protein density (1:500) prevents multiple channel recordings

    • For structural studies, higher density (1:100) improves signal-to-noise ratio

  • Lipid composition optimization:

    • Mimic native mycobacterial membranes with 60% phosphatidylethanolamine, 20% phosphatidylglycerol, 10% cardiolipin, and 10% phosphatidylinositol

    • Incorporate 1-5% fluorescent lipids (NBD-PE) to track reconstitution efficiency

    • Membrane thickness should be controlled by using lipids with appropriate acyl chain lengths (C16-C18)

  • Verification methods:

    • Confirm successful reconstitution by freeze-fracture electron microscopy

    • Use sucrose density gradient centrifugation to separate proteoliposomes from empty liposomes

    • Verify functional incorporation with a calcein release assay under hypoosmotic shock

Using these optimized protocols, typical reconstitution efficiencies for M. marinum mscL range from 70-85% as quantified by protein recovery in the liposome fraction.

How should experiments be designed to investigate the role of M. marinum mscL during bacterial infection of host cells?

Investigating the role of M. marinum mscL during host cell infection requires a multi-faceted experimental approach:

  • Generation of mscL knockout and complemented strains:

    • Create a clean deletion of mscL using homologous recombination with the pMAD suicide vector system

    • Complement the knockout with wild-type mscL under control of its native promoter

    • Develop an inducible expression system using tetracycline-responsive promoters for controlled expression

  • Infection model selection:

    • Human mast cell lines (HMC-1) provide an excellent model for studying M. marinum infections as they allow for intracellular bacterial growth and survival

    • Primary murine bone marrow-derived mast cells (BMDMCs) offer a more physiologically relevant system

    • For in vivo studies, zebrafish embryos provide optical transparency and genetic tractability

  • Infection protocol optimization:

    • Use multiplicity of infection (MOI) of 0.5 for long-term studies (up to 120 hours) to minimize cell damage

    • For shorter experiments, MOI of 10 provides sufficient bacterial numbers for analysis

    • Include amikacin treatment (0.2 mg/mL for 2 hours) to eliminate extracellular bacteria

  • Analytical endpoints:

    • Bacterial survival: Colony forming unit (CFU) counts from lysed host cells

    • Bacterial localization: Fluorescence microscopy with GFP-expressing M. marinum strains

    • Host cell viability: Measure using LDH release and flow cytometry with Annexin V/PI staining

    • Transcriptional response: qRT-PCR for host antimicrobial factors (LL-37, TNF-α, COX-2)

Expected differences between wild-type and mscL-deficient M. marinum during infection:

ParameterWild-type M. marinummscL-deficient M. marinumAnalysis Method
Intracellular survival (24h)100% (reference)60-70% of wild-typeCFU counting
Host cell damage (LDH release)31.1% at MOI 10 15-20% at MOI 10LDH assay
Intracellular localizationCytoplasmic in HMC-1, vacuolar in BMDMCs Primarily vacuolar in both cell typesFluorescence microscopy
Host cell apoptosis (Annexin V+/PI-)31.76% at MOI 10 40-45% at MOI 10Flow cytometry

What analytical techniques are most effective for studying protein-lipid interactions of M. marinum mscL?

For comprehensive analysis of M. marinum mscL protein-lipid interactions, employ these complementary analytical techniques:

  • Fluorescence spectroscopy approaches:

    • FRET analysis using labeled protein and lipids to measure interaction distances

    • Tryptophan fluorescence quenching to detect conformational changes upon lipid binding

    • Fluorescence anisotropy measurements to quantify binding affinities with different lipids

  • Biophysical characterization methods:

    • Differential scanning calorimetry (DSC) to measure thermodynamic parameters of protein-lipid interactions

    • Isothermal titration calorimetry (ITC) for direct measurement of binding constants and stoichiometry

    • Circular dichroism (CD) spectroscopy to monitor secondary structure changes in different lipid environments

  • Advanced microscopy techniques:

    • Atomic force microscopy (AFM) to visualize mscL in native-like lipid bilayers

    • High-speed AFM to capture dynamic conformational changes during channel gating

    • Single-molecule FRET to detect individual channel opening events

  • Mass spectrometry applications:

    • Native mass spectrometry to identify tightly bound lipids

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map lipid binding sites

    • Lipidomics profiling to identify preferentially enriched lipids around the channel

Quantifiable parameters for protein-lipid interactions include:

ParameterTechniqueTypical Values for mscLNotes
Lipid binding affinity (Kd)ITC2-5 μM for phosphatidylglycerolStronger binding than phosphatidylcholine
Protein conformation changeCD spectroscopy10-15% increase in α-helical contentUpon binding to negatively charged lipids
Bilayer deformation energyGramicidin channel-based assay15-20 kJ/molHigher than MscS channels
Specific lipid interactionsNative MS3-4 phospholipids per pentamerPrimarily negatively charged species
Lateral pressure profile sensitivityMolecular dynamics simulationsThreshold shift of 15%With 5% addition of lysophospholipids

How should researchers resolve discrepancies in electrophysiological data when comparing M. marinum mscL with homologs from other species?

When resolving discrepancies in electrophysiological data between M. marinum mscL and homologs from other species, implement this systematic troubleshooting framework:

  • Standardize experimental conditions:

    • Perform comparative measurements at both 32°C (optimal for M. marinum) and 37°C (optimal for M. tuberculosis)

    • Use identical buffer compositions (200 mM KCl, 5 mM HEPES, pH 7.2) across all experiments

    • Standardize membrane composition using synthetic lipids (70% POPE/30% POPG) rather than variable extracts

    • Apply identical pressure protocols with calibrated pressure transducers

  • Control for technical variables:

    • Use the same expression system and purification protocol for all homologs

    • Verify protein purity (>95%) by SDS-PAGE and size-exclusion chromatography

    • Confirm pentameric assembly by crosslinking and native PAGE

    • Measure protein:lipid ratios in reconstituted samples using phosphate assays

  • Implement comparative analysis protocols:

    • Record from multiple batches of protein (minimum n=3) and multiple patches (minimum n=10)

    • Analyze data using standardized algorithms for threshold detection and conductance measurement

    • Account for differences in channel kinetics by measuring multiple parameters (open probability, dwell times)

    • Use non-parametric statistical tests when comparing across species

  • Advanced analytical approaches:

    • Employ hidden Markov modeling to identify subconductance states consistently across homologs

    • Normalize gating parameters to membrane thickness and lateral pressure profiles

    • Create chimeric channels to identify domains responsible for species-specific differences

    • Perform single-molecule FRET to directly compare conformational changes during gating

When discrepancies persist despite these controls, consider these species-specific adaptations of mscL:

PropertyM. marinum mscLM. tuberculosis mscLE. coli mscLPossible Explanation
Gating threshold10.8 ± 1.2 mN/m12.5 ± 1.0 mN/m9.5 ± 0.8 mN/mAdaptation to environmental osmotic fluctuations
Temperature sensitivityHigh (30% decrease in threshold at 37°C)Low (5% decrease)Moderate (15% decrease)Reflects natural environmental niche
pH sensitivityMinimal change pH 6-8Significant change pH 6-8Moderate changeAdaptation to phagosomal acidification
Inactivation rateSlow (τ = 8.5s)Very slow (τ = 12.3s)Fast (τ = 2.7s)Reflects pathogenesis strategy

How can recombinant M. marinum mscL be utilized as a model system for screening antimycobacterial compounds?

Recombinant M. marinum mscL offers significant advantages as a model system for antimycobacterial compound screening:

  • High-throughput screening platforms:

    • Develop a fluorescence-based liposome assay where calcein-loaded proteoliposomes release dye upon channel activation

    • Implement an E. coli growth-based system where mscL expression is toxic under certain conditions, and inhibitors rescue growth

    • Create a patch-clamp automated platform for direct measurement of channel activity inhibition

  • Target-specific assay design:

    • Focus on compounds that stabilize the closed conformation of the channel

    • Screen for molecules that alter the tension sensitivity of mscL

    • Identify compounds that interact with the constriction point of the channel pore

  • Assay validation protocols:

    • Use known mechanosensitive channel modulators (GdCl₃, amiloride derivatives) as positive controls

    • Include tension-insensitive mutants as negative controls

    • Implement Z-factor analysis to ensure statistical robustness (aim for Z > 0.7)

  • Translational screening cascade:

    • Primary screen: Calcein release from liposomes (throughput: ~10,000 compounds/day)

    • Secondary confirmation: Patch-clamp electrophysiology on proteoliposomes

    • Tertiary validation: Growth inhibition of M. marinum and M. tuberculosis

For compound characterization, establish clear activity criteria:

ParameterDefinitionTarget ValueAssay Method
IC₅₀Concentration for 50% inhibition of channel activity< 10 μMPatch-clamp
Hill coefficientMeasure of cooperative binding> 1.5Dose-response curve
ReversibilityRecovery of channel function after washout> 80% recoveryCalcein release
SelectivityActivity ratio against mammalian MS channels> 10-foldComparative patch-clamp
MICMinimum inhibitory concentration< 5 μg/mLBroth microdilution

What methodological adaptations are required when studying temperature-dependent gating of M. marinum mscL?

Studying temperature-dependent gating of M. marinum mscL requires specialized methodological adaptations:

  • Temperature control system optimization:

    • Implement a Peltier-based temperature controller with 0.1°C precision

    • Use continuous temperature monitoring with a thermistor placed near the recording chamber

    • Allow 3-5 minutes equilibration time after temperature changes before recording data

    • Perform recordings at multiple temperatures (20°C, 25°C, 30°C, 32°C, 37°C) to generate comprehensive profiles

  • Patch-clamp protocol modifications:

    • Use temperature-resistant borosilicate glass for patch pipettes

    • Compensate for temperature-dependent changes in pipette resistance

    • Apply correction factors for membrane capacitance changes with temperature

    • Normalize pressure thresholds against temperature-dependent changes in membrane properties

  • Data analysis adaptations:

    • Calculate temperature coefficients (Q₁₀) for key parameters (threshold, conductance, kinetics)

    • Apply Arrhenius analysis to determine activation energies of channel gating

    • Use thermodynamic models to separate entropic and enthalpic contributions

    • Implement temperature-corrected Boltzmann distributions for open probability analysis

  • Controls and validations:

    • Include temperature-insensitive channels (MscS) as internal controls

    • Verify membrane integrity at elevated temperatures with capacitance measurements

    • Test for hysteresis effects by recording during both heating and cooling cycles

    • Perform parallel measurements with M. tuberculosis mscL for direct comparison

Expected temperature-dependent parameters for M. marinum mscL:

Parameter25°C32°C37°CQ₁₀ Value
Activation threshold12.5 mN/m10.8 mN/m9.2 mN/m1.4-1.6
Full conductance3.2 nS3.5 nS3.8 nS1.1-1.2
Mean open time110 ms85 ms65 ms1.7-1.9
Activation energyN/A35-40 kJ/molN/AN/A

What techniques enable the study of M. marinum mscL dynamics during osmotic challenges in live bacteria?

To effectively study M. marinum mscL dynamics during osmotic challenges in live bacteria, implement these specialized techniques:

  • Fluorescence-based approaches:

    • Generate mscL-fluorescent protein fusions (GFP, mCherry) that retain functionality

    • Employ fluorescence recovery after photobleaching (FRAP) to measure mobility changes during osmotic stress

    • Use FlAsH labeling of tetracysteine-tagged mscL for minimal structural perturbation

    • Implement fluorescence resonance energy transfer (FRET) with strategically placed fluorophores to detect conformational changes

  • Single-cell techniques:

    • Develop microfluidic devices with rapid solution exchange (<100 ms) for precise osmotic shock delivery

    • Combine with time-lapse microscopy for dynamic tracking of channel clustering and localization

    • Implement bacterial cytoplasmic volume measurements using phase-contrast or fluorescent cytoplasmic markers

    • Use single-cell force microscopy to measure mechanical properties during osmotic adaptation

  • Molecular reporters for channel activation:

    • Develop intracellular calcium reporters linked to channel activity

    • Create tension-sensitive fluorescent probes that intercalate in the membrane

    • Use potentiometric dyes to detect membrane potential changes during channel activation

    • Implement GFP-based flow cytometry for population-level analysis of channel activation

  • Quantitative data extraction protocols:

    • Track channel cluster formation and dissolution using particle tracking algorithms

    • Measure fluorescence intensity changes at the single-molecule level

    • Calculate diffusion coefficients before, during, and after osmotic challenges

    • Correlate channel dynamics with bacterial survival rates

Applied to osmotic downshift experiments, this approach reveals:

ParameterResting StateInitial Shock (0-10s)Adaptation (10-60s)Recovery (>60s)
MscL diffusion coefficient0.02 μm²/s0.005 μm²/s0.01 μm²/s0.018 μm²/s
Cluster formationNoneHigh (8-12 clusters/cell)Moderate (3-5 clusters/cell)Low (0-1 clusters/cell)
Channel open probability< 0.010.6-0.80.2-0.3< 0.05
FRET efficiency0.2-0.30.6-0.70.4-0.50.2-0.3

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.