Recombinant Mycobacterium marinum NADH-quinone oxidoreductase subunit K (nuoK) is a bioengineered protein derived from the nuoK gene (MMAR_1473) of M. marinum, a photochromogenic mycobacterium associated with aquatic environments and human infections . This protein is a critical component of NADH dehydrogenase I (NDH-1), also known as Complex I, a multi-subunit enzyme central to bacterial respiratory electron transport chains . The recombinant form is engineered with an N-terminal His tag for purification and functional studies, expressed in Escherichia coli or cell-free systems .
The sequence is:
MNPANYLYLSALLFTIGASGVLLRRNAIVMFMCVELMLNAVNLAFVTFARMHGHLDGQMI AFFTMVVAACEVVVGLAIIMTIFRTRKSASVDDANLLKG .
nuoK is part of NDH-1, which facilitates electron transfer from NADH to quinones, coupled with proton translocation across the membrane. This process generates a proton gradient essential for ATP synthesis . In M. marinum, NDH-1 operates alongside NDH-2 (Type II NADH-quinone oxidoreductase), but NDH-1 is more evolutionarily conserved and critical for pathogenicity .
The nuoK gene is part of the KEGG module M00144 (NADH:quinone oxidoreductase, prokaryotes), which includes subunits required for electron transport and proton pumping . The M. marinum genome encodes a functional NDH-1, unlike some mycobacteria that rely predominantly on NDH-2 .
Structural Studies: The recombinant protein enables investigation of NDH-1’s subunit interactions and quinone-binding sites.
Enzymatic Kinetics: Studies on NDH-2 in M. tuberculosis suggest a ping-pong mechanism for quinone reduction , but NDH-1’s kinetics remain under investigation.
Diagnostic Tools: Potential use as an antigen in serological assays for M. marinum infections, though clinical validation is pending .
Respiratory Versatility: M. marinum has >590 oxidoreductases, including NDH-1 components, reflecting adaptability to aquatic environments .
Metabolic Pathways: Coexistence of mevalonate (MVA) and DXP pathways for isoprenoid synthesis supports quinone production, critical for NDH-1 activity .
| Feature | M. marinum NDH-1 (nuoK) | M. tuberculosis NDH-1 | M. tuberculosis NDH-2 |
|---|---|---|---|
| Subunits | 14–15 subunits (including nuoK) | 14–15 subunits | Single subunit (45 kDa) |
| Quinone Interaction | Binds ubiquinone/menaquinone | Binds menaquinone | Binds menaquinone |
| Proton Translocation | 4 H+/2e⁻ (predicted) | 4 H+/2e⁻ (confirmed) | 0 H+/2e⁻ (no proton pumping) |
| Target for Therapies | Potential (structural studies ongoing) | Challenging (complexity) | High (absent in humans) |
Structural Elucidation: Crystallization of the full NDH-1 complex remains challenging due to its size and membrane-bound nature.
Therapeutic Targeting: NDH-1 inhibitors may disrupt M. marinum’s energy metabolism, but specificity is critical to avoid off-target effects in humans.
Evolutionary Studies: Comparative genomics with M. ulcerans (closely related but distinct in virulence) may reveal nuoK’s role in pathogenicity .
KEGG: mmi:MMAR_1473
STRING: 216594.MMAR_1473
Mycobacterium marinum is a pathogenic mycobacterium that causes granulomatous infections in poikilotherms (cold-blooded animals) and "swimming pool" granuloma in humans. It serves as an excellent model organism for studying mycobacterial pathogenesis for several key reasons:
M. marinum has a relatively fast generation time of approximately 4 hours, compared to M. tuberculosis which has a generation time of about 20 hours .
It requires only biosafety containment level 2, whereas M. tuberculosis requires higher containment levels, making M. marinum more accessible for research .
It shares significant genetic homology with M. tuberculosis, making findings potentially translatable to tuberculosis research.
The natural zebrafish host for M. marinum provides a well-established model system for studying mycobacterial pathogenesis in vivo .
M. marinum can be studied in both topical and systemic mouse infection models, allowing for diverse experimental approaches .
For these reasons, researchers utilize M. marinum to understand fundamental aspects of mycobacterial pathogenicity, host-pathogen interactions, and cellular mechanisms of infection that may apply to more hazardous mycobacterial species.
The NuoK subunit (counterpart of the mitochondrial ND4L subunit) is structurally characterized by:
Three transmembrane segments (TM1-3) arranged linearly and connected by short loops .
Two conserved glutamic acid residues located in adjacent transmembrane helices: KGlu-36 in TM2 and KGlu-72 in TM3 .
A short cytoplasmic loop (loop-1) between TM1 and TM2 containing two important arginine residues (KArg-25 and KArg-26) .
Extensive interaction with the NuoN subunit, with its C-terminus extending between NuoN and helix HL (an α-helix of NuoL) .
The subunit shows sequence similarity to the MrpC subunit of multisubunit Na⁺/H⁺ antiporters, although the conserved glutamic acid residues of NuoK are not conserved in MrpC . The spatial arrangement of these transmembrane segments and the positioning of charged residues within them are critical for the protein's function in energy transduction.
Mutation studies of the conserved residues in NuoK have revealed critical insights into its functional mechanism:
Mutation of the highly conserved KGlu-36 in TM2 to alanine or glutamine leads to complete loss of NDH-1 activities, indicating this residue is essential for energy transduction .
Mutation of KGlu-72 in TM3 causes moderate but significant reduction in activities, suggesting it plays a supporting role in the energy coupling mechanism .
Repositioning of KGlu-36 along TM2 to positions 32, 38, 39, and 40 allowed retention of substantial energy-transducing NDH-1 activities. This indicates that the exact position is less critical than proximity within the same helical face .
Double mutation of two arginine residues (R25A/R26A) in the cytoplasmic loop-1 between TM1 and TM2 dramatically reduces electron transfer rates and diminishes electrochemical gradient formation .
These findings suggest that the charged residues in NuoK participate, either directly or indirectly, in the coupling mechanism of NDH-1, likely in conjunction with NuoA and NuoJ subunits. The experimental approach of systematically relocating conserved residues provides a methodological framework for understanding the spatial requirements of functional residues in membrane proteins involved in energy transduction.
For studying M. marinum infection, researchers can employ several complementary experimental models:
Cellular models:
Human mast cell line (HMC-1): Useful for studying intracellular survival and replication. M. marinum localizes to the cytoplasm in these cells .
Primary murine bone marrow-derived mast cells (BMDMCs): Provide a more physiologically relevant system where M. marinum localizes to vacuoles .
Infection protocols typically use defined multiplicity of infection (MOI) ratios:
| Infection Condition | LDH Release (% increase over uninfected control) |
|---|---|
| MOI 0.5:1 | 4.20% |
| MOI 10:1 | 31.10% |
| MOI 25:1 | 43.70% |
In vivo models:
Methodology for isolating intracellular bacteria:
Analytical approaches:
Apoptosis assessment using Annexin V/PI staining:
| Infection Condition | Annexin V-/PI- | Annexin V+/PI- | Annexin V+/PI+ | Annexin V-/PI+ |
|---|---|---|---|---|
| Uninfected (control) | 99.80% | 0.20% | 0% | 0% |
| M. marinum MOI 10 | 58.52% | 31.76% | 2.98% | 6.70% |
| M. marinum MOI 25 | 58.24% | 29.37% | 4.25% | 8.14% |
Gene expression analysis: Evaluate mRNA expression of antimicrobial peptides (e.g., LL-37) and inflammatory mediators (e.g., COX-2, TNF-α) .
When specifically studying the role of respiratory chain components like NuoK, site-directed mutagenesis followed by activity assays represents the gold standard approach. Researchers should consider both electron transfer measurements and proton pumping assays to fully characterize the functional consequences of mutations.
The current evidence suggests that NuoK contributes to proton translocation in the bacterial NDH-1 complex through the following mechanisms:
NuoK likely works in conjunction with the antiporter-like subunits NuoL (16 TMs), NuoM (14 TMs), and NuoN (14 TMs) .
With only three transmembrane segments, NuoK probably doesn't function as an independent proton pump but rather contributes to a larger proton translocation machinery .
The three-dimensional structure indicates that NuoK interacts with NuoA (3 TMs), NuoJ (5 TMs), and likely NuoH (8 TMs) .
Together, this bundle of NuoAJKH might constitute a functional proton pump unit, with KGlu-36 of NuoK playing a critical role .
The conserved glutamic acid residues in TM2 and TM3 likely participate in a proton transfer pathway, with KGlu-36 being essential for this function .
To experimentally investigate this mechanism, researchers might employ:
Site-directed mutagenesis of specific residues in the proposed proton pathway
Proton pumping assays using pH-sensitive fluorescent probes
Structural studies to determine conformational changes during the catalytic cycle
Cross-linking studies to map the interaction interfaces between NuoK and other subunits
Molecular dynamics simulations to model proton movement through the complex
Analyzing host cell responses to M. marinum infection, particularly in relation to respiratory chain functions, requires a multi-faceted approach:
Temporal gene expression analysis:
Host cells infected with M. marinum show a biphasic pattern of increased mRNA expression for antimicrobial peptides like LL-37 and inflammatory mediators like COX-2/TNF-α during the first 24 hours of stimulation .
qRT-PCR can be used to quantify expression changes of genes involved in oxidative phosphorylation, mitochondrial function, and antimicrobial responses.
Cytotoxicity assessment:
Intracellular bacterial localization and interaction with host mitochondria:
Confocal microscopy with appropriate staining can determine whether M. marinum co-localizes with mitochondria or disrupts the host cell's respiratory chain.
Electron microscopy can provide high-resolution images of bacterial compartmentalization and potential interactions with host organelles.
Metabolic analysis:
Seahorse XF analyzer can measure changes in oxygen consumption rate (OCR) and extracellular acidification rate (ECAR) in infected cells.
Stable isotope labeling can track metabolic flux through glycolysis and the TCA cycle in response to infection.
Mitochondrial function assessment:
Membrane potential assays using JC-1 or TMRM dyes
Measurement of ATP production
Assessment of reactive oxygen species production
These methodologies would help researchers understand whether M. marinum infection impacts host cell bioenergetics and whether bacterial respiratory chain components like NuoK influence these host-pathogen interactions.
To investigate the functional interactions between NuoK and other membrane subunits of the NDH-1 complex, researchers should consider the following experimental approaches:
Complementary genetic approaches:
Generate single and double mutants of conserved residues in NuoK and potential interacting partners.
Create chimeric proteins by swapping domains between NuoK and related proteins.
Perform suppressor mutation screens to identify compensatory mutations that restore function.
Biochemical interaction studies:
Implement chemical cross-linking followed by mass spectrometry to map interaction interfaces.
Use co-immunoprecipitation with tagged variants of NuoK and other subunits.
Perform blue native PAGE to analyze intact complex assembly in various mutants.
Structural biology approaches:
Cryo-electron microscopy of the intact NDH-1 complex with wild-type and mutant NuoK.
X-ray crystallography of subcomplexes containing NuoK and interacting partners.
NMR spectroscopy of isolated domains to detect conformational changes.
Functional assays:
Measure NADH:ubiquinone oxidoreductase activity in membrane preparations.
Assess proton pumping efficiency using pH-sensitive fluorescent probes.
Determine the impact on membrane potential using voltage-sensitive dyes.
Computational approaches:
Molecular dynamics simulations to model the dynamics of the NuoK subunit within the complex.
Quantum mechanics/molecular mechanics (QM/MM) calculations to model potential proton transfer pathways.
Coevolutionary analysis to identify potentially interacting residues.
Expressing and purifying recombinant membrane proteins like NuoK presents several challenges that researchers should anticipate:
Expression system selection:
E. coli-based systems may struggle with proper folding and insertion of mycobacterial membrane proteins.
Mycobacterial expression systems (M. smegmatis) may provide a more native-like membrane environment but yield lower protein quantities.
Cell-free expression systems can be considered for highly toxic membrane proteins.
Solubilization strategies:
Multiple detergents should be screened (DDM, LMNG, digitonin) to identify optimal solubilization conditions.
Amphipols or nanodiscs can be used to maintain protein stability after extraction.
Consider using styrene maleic acid (SMA) copolymers to extract membrane proteins with their native lipid environment.
Purification optimization:
Implement two-step affinity purification using dual tags (His-tag plus additional tag).
Size exclusion chromatography is essential to separate monomeric protein from aggregates.
Include stabilizing agents (glycerol, specific lipids) in all buffers.
Functional validation:
Develop activity assays applicable to the isolated subunit or reconstituted complexes.
Confirm proper folding using circular dichroism or limited proteolysis.
Verify membrane insertion using proteoliposome reconstitution.
Troubleshooting low yields:
Optimize codon usage for the expression host.
Test different fusion partners to enhance solubility.
Consider expression as inclusion bodies followed by refolding for structural studies.
These methodological considerations aim to overcome the inherent difficulties in working with hydrophobic membrane proteins from mycobacterial species.
When faced with conflicting data regarding the intracellular localization of M. marinum in different cell types, researchers should consider several factors:
Cell type-specific differences:
Methodological considerations:
Fixation techniques can affect apparent localization (chemical fixers versus cryofixation).
Resolution limits of different microscopy techniques (confocal versus electron microscopy).
Specificity of markers used to identify subcellular compartments.
Temporal dynamics:
Initial entry versus established infection may show different localization patterns.
The bacteria may escape from phagosomes into the cytosol at specific time points.
Time-course experiments with multiple time points are essential.
Bacterial strain variation:
Different strains of M. marinum may exhibit different intracellular behaviors.
Mutations affecting cell wall components may influence phagosomal escape.
Laboratory-adapted strains may behave differently than clinical isolates.
Resolution approaches:
Use complementary techniques (fluorescence microscopy, electron microscopy, subcellular fractionation).
Implement live cell imaging to track bacterial movement between compartments.
Apply correlative light and electron microscopy (CLEM) to combine the advantages of both approaches.
Utilize super-resolution microscopy techniques to improve visualization of bacterial-host interfaces.
By carefully considering these factors and implementing rigorous controls, researchers can better interpret seemingly conflicting data and develop a more nuanced understanding of the dynamic nature of M. marinum's intracellular life cycle.
Several promising research directions could significantly advance our understanding of NuoK function in Mycobacterium marinum:
These research directions would contribute to a more comprehensive understanding of bacterial energy metabolism and potentially reveal new targets for antimycobacterial interventions.