Recombinant Mycobacterium marinum Protease HtpX homolog (htpX)

What is the basic structure and function of Mycobacterium marinum Protease HtpX homolog?

Mycobacterium marinum Protease HtpX homolog (htpX) is a membrane-bound zinc metalloprotease consisting of 286 amino acids. The protein participates in the proteolytic quality control of membrane proteins in mycobacteria . The full-length protein (UniProt ID: B2HRQ7) contains transmembrane domains that anchor it to the bacterial membrane, with the catalytic domain exposed to perform its proteolytic functions . Structurally, htpX is hydrophobic in nature, allowing it to reside in and interact with biological membranes, which is consistent with its role in membrane protein quality control .

How does the amino acid sequence of M. marinum htpX compare to homologs in other mycobacterial species?

The M. marinum htpX protein sequence (MTWHPHANRLKTFLLLVGMSAMIVFFGALFGRTALILAVLFAVGMNVYVYFNSDKLALRAMHAQPVSELQAPAMYRIVRELATSAHQPMPRLYISDTAAPNAFATGRNPRNAAVCCTTGILALLNERELRAVLGHELSHVYNRDILISCIAGALASVITALANMAMWAGMFGGNRDGQNPFALLLVSLLGPIAATVVRMAVSRSREYQADESGAVLTGDPLALASALRKISGGVQLAPLPPEPQLASQAHLMIANPFRAGERIGSLFSTHPPIEDRIRRLEQMARG) shares significant homology with other bacterial proteases . While specific comparison data with other mycobacterial species isn't directly provided in the search results, computational proteomic studies of related proteases suggest that these proteins typically range from 279 to 336 amino acids and share conserved functional domains . Multiple sequence alignment and molecular phylogenetic analysis would reveal specific conservation patterns among mycobacterial htpX homologs.

What are the physicochemical properties of recombinant htpX that researchers should be aware of?

Recombinant htpX from M. marinum has several important physicochemical properties:

The protein is typically expressed with an N-terminal His-tag to facilitate purification and is available as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE . Researchers should note that repeated freeze-thaw cycles are not recommended, and working aliquots should be stored at 4°C for up to one week, with longer-term storage at -20°C/-80°C .

What expression systems are most effective for producing recombinant M. marinum htpX?

E. coli has been successfully utilized as an expression system for recombinant full-length M. marinum Protease HtpX homolog . Similar to other mycobacterial membrane proteases, the effectiveness of the expression system depends on the protein construct design. For instance, with the related mycobacterial protease MarP, only a partial protein (121-397 a.a.) lacking the transmembrane domain was successfully expressed in the yeast Pichia pastoris as a glycosylated active protease .

For optimal expression of full-length htpX in E. coli, researchers should consider:

• Using BL21(DE3) or similar strains optimized for membrane protein expression

• Adding an N-terminal His-tag for purification purposes

• Optimizing induction conditions (temperature, IPTG concentration, induction time)

• Including detergents in lysis buffers to solubilize the membrane-bound protein

The challenges in expressing full-length membrane proteins may necessitate designing truncated versions lacking transmembrane domains for some applications, similar to the approach used for MarP .

What purification strategies yield the highest purity and activity of recombinant htpX?

Nickel affinity chromatography is the primary purification method for His-tagged recombinant htpX . Based on experiences with similar mycobacterial proteases like MarP, a multi-step purification protocol is recommended:

• Initial capture using Ni-NTA affinity chromatography with imidazole gradient elution

• Secondary purification via size exclusion chromatography to remove aggregates

• Final polishing using ion exchange chromatography if necessary

For optimal results, consider these methodological details:

Activity assays should be performed immediately after purification to confirm that the protein maintains its proteolytic function .

How can researchers overcome solubility challenges when working with membrane-associated htpX?

The membrane-associated nature of htpX presents significant solubility challenges. Based on approaches used for similar proteases, researchers can implement the following strategies:

• Detergent screening: Systematic testing of detergents (CHAPS, DDM, Triton X-100) at various concentrations to identify optimal solubilization conditions.

• Construct design: Creating truncated versions lacking transmembrane domains while preserving the catalytic site, similar to the successful approach with MarP (residues 121-397) .

• Fusion partners: Adding solubility-enhancing fusion partners such as MBP (maltose-binding protein) or SUMO.

• Co-expression with chaperones: Co-expressing with molecular chaperones like GroEL/GroES to enhance proper folding.

• Refolding protocols: If expression yields inclusion bodies, developing refolding protocols using urea or guanidine hydrochloride gradients.

The choice between full-length or truncated constructs depends on the research question, with full-length being more challenging but potentially preserving important structural elements for certain applications .

What enzymatic assays are most suitable for measuring htpX protease activity?

Based on methodologies used for similar metalloproteases, the following assays can be adapted for htpX:

• Fluorogenic peptide substrates: Using peptides with fluorogenic groups (e.g., 7-amino-4-methylcoumarin) that increase fluorescence upon cleavage.

• FRET-based assays: Employing peptides with fluorophore-quencher pairs that generate signals upon proteolytic separation.

• Zymography: Incorporating substrates into polyacrylamide gels to visualize protease activity as clear bands on a stained background.

• Synthetic chromogenic substrates: Using substrates that release detectable chromophores upon cleavage.

The assay buffer composition significantly affects activity measurements and should typically include:

• 50 mM Tris-HCl or HEPES (pH 7.5-8.0)

• 100-150 mM NaCl

• 1-5 mM ZnCl₂ (as htpX is a zinc-dependent metalloprotease)

• 0.01-0.05% non-ionic detergent (to maintain solubility)

Activity measurements should be validated using specific metalloprotease inhibitors like 1,10-phenanthroline to confirm metalloprotease-specific activity .

How does htpX contribute to Mycobacterium marinum pathogenesis and survival mechanisms?

Although the search results don't directly address htpX's role in M. marinum pathogenesis, we can infer its potential functions based on related studies. As a membrane-bound zinc metalloprotease involved in proteolytic quality control, htpX likely contributes to:

• Membrane protein homeostasis: Maintaining proper membrane composition under stress conditions, similar to other bacterial proteases .

• Stress response: Potentially playing a role in acid resistance, similar to MarP in M. tuberculosis, which is involved in survival within macrophages .

• Host-pathogen interactions: Possibly modulating host immune responses, as seen with MarP, which affects cytokine release (TNF-α and IL-10) from human monocytes .

The ESX-1 secretion system of M. marinum has been shown to manipulate host autophagy processes, inducing autophagosome formation while simultaneously blocking autophagic flux . While not directly linked to htpX in the search results, proteases like htpX might participate in these complex host-pathogen interactions through protein processing or degradation mechanisms.

What inhibitors effectively modulate htpX protease activity in experimental settings?

Based on the zinc metalloprotease nature of htpX, researchers can utilize several classes of inhibitors for experimental modulation:

When designing inhibitor experiments, researchers should:

• Establish dose-response curves for each inhibitor

• Confirm specificity using structurally unrelated inhibitors

• Include controls with unrelated proteases to verify selectivity

• Consider potential off-target effects when interpreting results

Inhibitor studies are valuable not only for biochemical characterization but also for elucidating the biological functions of htpX in cellular contexts .

How can recombinant htpX be utilized in studying mycobacterial membrane protein quality control systems?

Recombinant htpX can serve as a powerful tool for investigating mycobacterial membrane protein quality control through several advanced applications:

• Substrate identification: Using proteomics approaches (such as SILAC or TMT labeling) to compare protein abundance in systems with normal versus depleted htpX levels.

• Reconstituted in vitro systems: Developing liposome-based systems with purified htpX to study direct proteolytic activities on candidate substrates.

• Structural biology: Utilizing cryo-EM or X-ray crystallography of htpX alone or in complex with substrates to understand recognition and cleavage mechanisms.

• Protein-protein interaction networks: Identifying htpX interaction partners using approaches like BioID or proximity labeling to map the broader quality control network.

Based on protein-protein interaction analysis of related proteases, researchers should investigate htpX interactions with potential partners involved in protein folding and degradation pathways . Investigation of conserved residues (both exposed and buried) identified through evolutionary rate analysis can provide insights into functional sites and substrate recognition mechanisms.

What genetic manipulation techniques have been successful for studying htpX function in mycobacteria?

While the search results don't specifically address genetic manipulation of htpX in M. marinum, we can draw on approaches used for other mycobacterial genes:

• Homologous recombination: Single and double crossover strategies have been successfully employed in M. marinum, as demonstrated with the crtB locus . For htpX, researchers could:

  • Design constructs with ~1 kb homology arms flanking the htpX gene

  • Use plasmids with sacB for counter-selection on sucrose

  • Confirm recombination events via Southern blot analysis

• CRISPR-Cas9 systems: Adapted for mycobacteria to achieve more efficient gene editing.

• Conditional knockdown systems: Using tetracycline-inducible or protein degradation tag systems to study essential genes.

• Complementation strategies: Reintroducing wild-type or mutant versions of htpX to confirm phenotypes and perform structure-function analyses.

The success of genetic manipulation in M. marinum suggests that these approaches can be effectively applied to study htpX function, with gene replacement events achievable at reasonable frequencies .

How does htpX compare functionally with other mycobacterial proteases like MarP?

Although direct comparative studies between htpX and MarP are not provided in the search results, we can analyze their likely functional relationships:

The two proteases likely represent distinct but potentially complementary systems for maintaining mycobacterial membrane integrity and function during infection. While MarP has been directly implicated in acid resistance and macrophage survival , htpX's role may be more focused on general membrane protein quality control during various stress conditions .

What computational approaches are most valuable for predicting htpX substrates and interaction partners?

Based on computational proteomic methodologies described for related proteases , researchers can employ several approaches to predict htpX substrates and interaction partners:

• Sequence-based cleavage site prediction:

  • Use machine learning algorithms trained on known metalloprotease cleavage sites

  • Analyze the frequency of amino acid residues surrounding potential cleavage sites

  • Apply sliding window analysis to identify sequence motifs

• Structural modeling and docking:

  • Generate homology models of htpX based on known metalloprotease structures

  • Perform molecular docking with candidate substrate peptides

  • Use molecular dynamics simulations to assess binding stability

• Network analysis approaches:

  • Identify proteins co-expressed with htpX under relevant conditions

  • Map interaction networks based on STRING database predictions

  • Look for functional partners involved in related processes (e.g., protein folding, stress response)

• Evolutionary conservation analysis:

  • Use ConSurf or similar tools to identify conserved surface residues

  • Apply co-evolution analysis to detect potential interaction interfaces

  • Examine conservation patterns across related bacterial species

The computational study of protease HtpX homolog in Polynucleobacter necessarius revealed that functional partners include proteins like def, fmt, ftsH, and grpE , suggesting that similar partners might interact with M. marinum htpX in coordinating protein quality control networks.

What controls are essential when studying recombinant htpX activity in vitro?

When designing experiments to study recombinant htpX activity, researchers should implement comprehensive controls:

Additionally, researchers should express and purify a related but functionally distinct protease (e.g., a serine protease) as a control to confirm that observed activities are specific to metalloproteases like htpX .

How should researchers design experiments to study htpX's role in mycobacterial stress response?

To investigate htpX's role in mycobacterial stress response, researchers should design multifaceted experimental approaches:

• Genetic manipulation studies:

  • Create conditional knockdown or knockout strains

  • Complement with wild-type or catalytically inactive htpX

  • Monitor growth under various stress conditions (acid, oxidative, nitrosative stress)

• Transcriptional analysis:

  • Measure htpX expression changes during stress using qRT-PCR

  • Perform RNA-seq to identify co-regulated genes

  • Use reporter constructs to monitor promoter activity

• Proteomics approaches:

  • Quantify changes in membrane protein composition in htpX-deficient strains

  • Identify accumulating substrates using stable isotope labeling

  • Monitor membrane protein turnover rates

• Infection models:

  • Compare wild-type and htpX-deficient strains in macrophage infection assays

  • Evaluate survival in acidified phagosomes

  • Assess bacterial persistence in animal models

When designing these experiments, researchers should consider that htpX may function similarly to MarP in contributing to acid resistance and survival in macrophages , while also participating in general membrane protein quality control like other bacterial HtpX homologs .

What methodological challenges should be anticipated when working with membrane-associated proteases like htpX?

Researchers working with membrane-associated proteases like htpX should prepare for several methodological challenges:

• Solubility and purification issues:

  • Difficulty maintaining protein solubility throughout purification

  • Detergent interference with activity assays

  • Potential for protein aggregation and inclusion body formation

• Activity assessment complications:

  • Finding appropriate substrates that work in detergent-containing buffers

  • Distinguishing specific activity from background protease contamination

  • Maintaining enzyme stability during prolonged assays

• Structural characterization obstacles:

  • Challenges in obtaining diffraction-quality crystals

  • Detergent micelle interference with structural studies

  • Conformational heterogeneity affecting structural determination

• Reconstitution difficulties:

  • Achieving proper orientation in artificial membrane systems

  • Maintaining native-like activity after reconstitution

  • Accessing both sides of the membrane for substrate addition

To address these challenges, researchers should consider using nanodiscs or liposomes for reconstitution, developing novel solubilization strategies, and employing advanced structural techniques like cryo-EM that can handle membrane proteins more effectively than traditional crystallography .

How does current research on mycobacterial proteases inform potential therapeutic strategies?

Current research on mycobacterial proteases like htpX and MarP reveals several potential therapeutic strategies:

• Protease inhibitor development: The structural and functional characterization of mycobacterial proteases provides targets for developing specific inhibitors that could disrupt bacterial survival mechanisms. The protease MarP has been shown to influence mycobacterial survival in macrophages, suggesting that inhibitors targeting this and similar proteases could compromise bacterial persistence .

• Immune modulation approaches: The finding that MarP can promote the release of TNF-α and IL-10 from human monocytes indicates that mycobacterial proteases can modulate host immune responses . This suggests potential immunotherapeutic approaches targeting these interactions.

• Membrane integrity disruption: As htpX is involved in membrane protein quality control, targeting this system could potentially compromise membrane integrity, especially under stress conditions encountered during infection .

• Combination therapies: Understanding how proteases like htpX contribute to stress responses could inform the development of combination therapies that simultaneously target conventional drug targets and stress response systems.

The computational identification of conserved and exposed residues in protease homologs provides specific structural targets that could be exploited for drug development, potentially leading to more effective therapeutic strategies against mycobacterial infections .

What emerging technologies are advancing our understanding of htpX and related mycobacterial proteases?

Several emerging technologies are revolutionizing research on mycobacterial proteases like htpX:

• Cryo-electron microscopy (Cryo-EM): Enabling structural determination of membrane proteins without crystallization, offering insights into htpX's membrane-associated structure.

• Native mass spectrometry: Allowing analysis of intact membrane protein complexes to identify interaction partners and structural organization.

• Proteomic approaches for substrate identification:

  • TAILS (Terminal Amine Isotopic Labeling of Substrates)

  • PICS (Proteomic Identification of Cleavage Sites)

  • SILAC combined with quantitative proteomics

• Advanced genetic tools:

  • CRISPR interference for conditional knockdowns

  • CRISPRi-seq for genome-wide functional screening

  • Inducible degradation systems for temporal control

• Single-cell techniques:

  • Single-cell RNA-seq to examine heterogeneous responses

  • Microfluidic systems to monitor individual bacterial responses to stress

• Computational developments:

  • Machine learning approaches for substrate prediction

  • Molecular dynamics simulations of membrane-protein interactions

  • Systems biology models integrating protease networks

These technologies are providing unprecedented insights into protease function and regulation in mycobacteria, offering new perspectives on their roles in pathogenesis and potential as therapeutic targets .

How might htpX interact with host autophagy pathways during mycobacterial infection?

While the search results don't directly link htpX to autophagy pathways, we can hypothesize potential interactions based on what we know about M. marinum infection strategies:

• Potential role in ESX-1 system modulation: M. marinum uses its ESX-1 secretion system to simultaneously induce and repress host autophagy . As a membrane-associated protease, htpX might process proteins involved in this secretion system, indirectly influencing its impact on host autophagy.

• Membrane damage response: The ESX-1 system secretes ESAT-6, which damages host membranes . htpX could potentially be involved in maintaining bacterial membrane integrity during this process or responding to host defense mechanisms triggered by membrane damage.

• TORC1 complex interaction: M. marinum recruits activators of the host TORC1 complex to the mycobacteria-containing vacuole in an ESX-1-dependent manner . htpX might process bacterial factors that influence this recruitment or respond to the altered nutrient environment created by TORC1 modulation.

• Proteolytic processing of effectors: As a quality control protease, htpX might process bacterial effector proteins that interact with host autophagy machinery, ensuring their proper folding and function.

Research combining genetic manipulation of htpX with host autophagy monitoring (using LC3 conversion assays, autophagosome formation visualization, and autophagic flux measurements) would be valuable for testing these hypothesized interactions and further understanding the complex relationship between mycobacterial proteases and host autophagy pathways .