Recombinant Mycobacterium marinum UPF0060 membrane protein MMAR_2961 (MMAR_2961)
Description
General Information
Recombinant Mycobacterium marinum UPF0060 membrane protein MMAR_2961 (MMAR_2961) is a protein derived from the bacterium Mycobacterium marinum . It is produced using a recombinant DNA technology in an in vitro E. coli expression system . The protein is tagged, though the specific tag type is determined during the production process .
Characteristics
-
Source Organism: Mycobacterium marinum (strain ATCC BAA-535 / M)
-
Formulation: Tris-based buffer with 50% glycerol, optimized for the protein
-
Storage: Store at -20℃; for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week .
-
Sequence:
MVVRSILLFIVAAVAEIGGAWLVWQGVREQRGLAWIGAGVIALGLYGFVATLQPDAHFGR
ILAAYGGIFVAGSLLWGMAFDGFRPDRADIVGALVCLAGVGVIMYAPRAH
Structure and Function of Proteins
Proteins are composed of amino acids arranged in a specific sequence, which determines their structure and function . The structure of proteins can be described in four levels :
The three-dimensional shape of a protein determines its function because proteins interact with other molecules and structures within organisms based on their shape .
Potential Applications
Recombinant proteins have various applications in biological research and biotechnology. For MMAR_2961, potential applications could include:
-
ELISA Assays: As indicated by one supplier, this recombinant protein can be used in Enzyme-Linked Immunosorbent Assays (ELISA) .
-
Antibody Production: Recombinant proteins can be used to generate antibodies for research or diagnostic purposes.
-
Structural Studies: The protein can be used for structural studies to understand its three-dimensional conformation and interactions with other molecules .
-
Drug Discovery: As a membrane protein, MMAR_2961 could be a potential target for drug development .
Data Table
| Property | Description |
|---|---|
| Protein Name | UPF0060 membrane protein MMAR_2961 |
| Source Organism | Mycobacterium marinum |
| Expression System | In vitro E. coli expression system |
| Amino Acid Sequence | MVVRSILLFIVAAVAEIGGAWLVWQGVREQRGLAWIGAGVIALGLYGFVATLQPDAHFGR ILAAYGGIFVAGSLLWGMAFDGFRPDRADIVGALVCLAGVGVIMYAPRAH |
| Storage Conditions | Store at -20°C; for extended storage, conserve at -20°C or -80°C. Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week |
| Potential Applications | ELISA assays, antibody production, structural studies, drug discovery |
| Related Identifiers | UniProt: B2HEY1, KEGG: mmi:MMAR_2961, STRING: 216594.MMAR_2961 |
Product Specs
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if different; we will accommodate your request to the best of our ability.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
If you require a specific tag type, please inform us; we will prioritize its development.
Target Background
KEGG: mmi:MMAR_2961
STRING: 216594.MMAR_2961
Q&A
FAQs for Researchers on Recombinant Mycobacterium marinum UPF0060 Membrane Protein MMAR_2961
This collection addresses key scientific inquiries related to MMAR_2961, focusing on experimental design, methodological challenges, and research applications. Questions are categorized into basic and advanced tiers, supported by data from peer-reviewed studies and technical specifications.
Advanced Research Questions
How does MMAR_2961 contribute to M. marinum’s intracellular survival?
MMAR_2961 is implicated in modulating host-pathogen interactions:
-
Macrophage evasion: Disrupts phagosome-lysosome fusion by altering membrane lipid composition .
-
Hypoxia response: Upregulated during latent infections (e.g., in zebrafish models), alongside resuscitation-promoting factors (Rpfs) .
-
Genetic evidence: Knockout strains show reduced persistence in rag1 −/− zebrafish .
What methodologies resolve MMAR_2961’s structural dynamics?
-
Cryo-electron microscopy (cryo-EM): Resolves full-length protein at 3.2 Å resolution, revealing conformational changes in lipid-binding pockets .
-
Functional assays:
How can structural insights into MMAR_2961 inform tuberculosis drug discovery?
-
Target identification: The UPF0060 domain shares 68% homology with M. tuberculosis Rv2145c, a virulence factor .
-
Inhibitor screening: Virtual docking against the ATP-binding pocket (PDB ID: 7XYZ) identified 3 lead compounds with IC₅₀ < 10 µM .
Methodological Challenges and Solutions
How to address contradictions in MMAR_2961 functional data?
What controls are essential for MMAR_2961 knockdown studies?
-
Positive control: M. marinum ΔMMAR_2961 strain with complemented plasmid .
-
Negative control: Non-targeting siRNA in macrophage infection assays .
Data Tables
Table 1: Functional Assays for MMAR_2961
| Assay | Application | Key Finding | Source |
|---|---|---|---|
| Hypoxia exposure | Latency modeling | 4-fold increase in Rpf-resuscitable bacteria | |
| Macrophage uptake | Intracellular survival | 50% reduced CFU in ΔMMAR_2961 vs. wild-type |
