Recombinant Mycobacterium marinum UPF0353 protein MMAR_2288 (MMAR_2288)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Mycobacterium marinum UPF0353 protein MMAR_2288 is a protein derived from Mycobacterium marinum, a bacterium known to cause tuberculosis-like diseases in fish and cutaneous granulomas in humans . Proteins are versatile macromolecules involved in pretty much every cellular process, including cellular repair and maintenance . The MMAR_2288 protein is annotated as a UPF0353 protein, indicating it belongs to a protein family of unknown function (UPF) . Recombinant production implies that the protein is produced using genetic engineering techniques, allowing for detailed study and potential applications.

Role in Host-Pathogen Interactions

M. marinum serves as a model organism for studying host-pathogen interactions, particularly in the context of tuberculosis . Proteins like TrafE play a crucial role in how the host cell responds to infection . TrafE is recruited to Mycobacterium-containing vacuoles (MCVs) and endolysosomes in a membrane damage- or tension-dependent manner. The absence of TrafE impairs the autophagy restriction of M. marinum, highlighting its importance in the host's defense mechanisms .

Relevance to Aging and Neurodegenerative Diseases

Research indicates that maintaining cellular fitness and function requires continuous protein balance or homeostasis . A new study has identified a previously unknown cell-protecting function in a class of proteins that might be used to achieve healthy aging and treat neurodegenerative diseases . Proteins are versatile macromolecules involved in pretty much every cellular process, including cellular repair and maintenance . Dysfunction or accumulation of misfolded proteins can lead to diseases like Alzheimer’s and Parkinson’s .

Experimental Evidence

ExperimentDescriptionResults
TrafE recruitment to MCVsMonitoring the subcellular localization of GFP fusions by live confocal microscopy over 24 hours in M. marinum-infected cells.GFP-TrafE showed robust recruitment to MCVs, sustained over the infection time course, predominantly in the area of M. marinum bacteria poles .
Transcriptional profile monitoringReal-time quantitative PCR (RT q-PCR) to monitor the transcriptional profile in control and infected cells.Up to fourfold upregulation of trafE already at 1 hour post-infection .
Intracellular growth assaysEvaluating the overexpression phenotype of TrafC, TrafD, and TrafE during infection with bioluminescent M. marinum.Intracellular growth of M. marinum WT remained unaffected in cells overexpressing TrafC or TrafD, but this growth was significantly hampered when TrafE was overexpressed, suggesting TrafE plays a crucial role in infection control .
K63-linked polyubiquitination in trafE-KO cellsAssessing total levels of polyubiquitin-positive MCVs or K63-linked polyubiquitinylated MCVs in M. marinum-infected WT or trafE-KO cells using antibodies.The fraction of K63-linkage positive MCVs was drastically reduced in trafE-KO cells, suggesting that TrafE is involved in K63-linked polyubiquitin tagging of MCVs and bacteria .
Functional importance of RING domainGenerating truncated versions of TrafE expressed in the trafE-KO background to dissect the functional importance of the RING and TRAF-N regions.Absence of the N-terminal RING domain resulted in complete loss of TrafE recruitment to MCVs throughout the infection time-course. Both truncated proteins failed to complement the trafE-KO, indicating that both the RING and TRAF-N domains are required for TrafE E3 ligase activity . Additionally, the RING domain permits dimerization of TRAF trimers and formation .

Potential Applications

  • Drug Discovery: Identifying the function of MMAR_2288 could reveal novel drug targets for treating M. marinum infections, especially in cases resistant to existing antibiotics.

  • Understanding Pathogenesis: Elucidating the protein's role in the bacterium's life cycle and interaction with host cells can provide insights into the pathogenesis of mycobacterial infections.

  • Biotechnological Applications: Recombinant MMAR_2288 could be used in diagnostic assays or as a target for developing new therapeutic strategies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MMAR_2288; UPF0353 protein MMAR_2288
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Mycobacterium marinum (strain ATCC BAA-535 / M)
Target Names
MMAR_2288
Target Protein Sequence
MTLPLLGPMTLSGFAHSWFFLFIFVIAGLIAVYVVLQLARQKRMLRFANMELLESVAPQR PSRFRHIPAMLLALSLVLFTVAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATDVEPNRMV AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKAALDKLQFADRTATGEAI FTALQAIATVGAVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPIS TISFGTPYGFVEINDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELNSVYASLQQQIGY ETIRGDASMGWLRLGALVLVAAALAALLINRRLPT
Uniprot No.

Target Background

Database Links
Protein Families
UPF0353 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MMAR_2288 protein?

MMAR_2288 is a UPF0353 protein found in Mycobacterium marinum, consisting of 335 amino acids. It belongs to a family of proteins with uncharacterized functions (UPF stands for Uncharacterized Protein Family). The protein is identified with UniProt ID B2HPD3 . The computational structure model is accessible through the RCSB PDB under identifier AF_AFB2HPD3F1 .

What are the predicted functions of MMAR_2288?

The exact functions of MMAR_2288 remain largely uncharacterized, which is typical for UPF proteins. Sequence analysis suggests it contains transmembrane domains, indicating it may be a membrane-associated protein . While the specific biochemical activities are unknown, structural features suggest potential roles in:

  • Membrane integrity or transport

  • Protein-protein interactions within bacterial systems

  • Possible involvement in stress responses

Methodologically, researchers should employ comparative genomics, structural prediction algorithms, and targeted functional assays to elucidate potential roles.

How should researchers design expression systems for MMAR_2288?

Based on available data, MMAR_2288 has been successfully expressed in E. coli with an N-terminal His-tag . For optimal expression, consider the following methodology:

Expression System Options:

Expression Protocol:

  • Culture bacteria to mid-log phase (OD600 0.6-0.8)

  • Induce with IPTG (0.1-1.0mM) or appropriate inducer

  • Reduce temperature to 16-25°C after induction

  • Express for 4-16 hours depending on temperature

  • Harvest cells and lyse using appropriate detergents for membrane proteins

  • Purify using nickel affinity chromatography followed by size exclusion

Success should be verified through SDS-PAGE, Western blotting, and preliminary functional assays before proceeding to detailed characterization.

What statistical approaches are appropriate for MMAR_2288 experimental data?

Statistical analysis for MMAR_2288 research should follow established principles of experimental design :

  • Power Analysis for Sample Size:

    • Determine appropriate replication levels before experimentation

    • For binding studies, typically n=3-5 independent experiments

    • For complex phenotypic assays, higher replication (n>5) may be needed

  • Appropriate Statistical Tests:

    • Binding data: Non-linear regression for KD determination

    • Mutational studies: ANOVA with post-hoc tests (Tukey's or Bonferroni)

    • Expression studies: t-tests or ANOVA with appropriate multiple testing correction

  • Advanced Data Analysis:

    • Principal component analysis for complex datasets

    • Model-based clustering for identifying patterns in expression data

    • Hierarchical clustering for relating MMAR_2288 to other mycobacterial proteins

  • Experimental Design Structures:

    • Randomized complete block designs for controlling batch effects

    • Factorial designs for testing multiple conditions

    • Split-plot designs for nested experimental factors

Always include appropriate positive and negative controls, and ensure proper randomization to minimize bias in results interpretation.

How can crystallography techniques be optimized for MMAR_2288 structural studies?

Structural determination of MMAR_2288 requires specialized approaches given its predicted membrane association:

  • Protein Preparation Optimization:

    • Purify to >95% homogeneity using affinity and size exclusion chromatography

    • Screen detergents (DDM, LDAO, C8E4) for optimal stability

    • Assess protein stability via thermal shift assays

    • Consider protein engineering to remove flexible regions

  • Crystallization Strategy:

    • Implement sparse matrix screening with commercial kits

    • For membrane proteins, consider lipidic cubic phase crystallization

    • Explore co-crystallization with stabilizing antibodies

    • Optimize promising conditions by varying precipitant, pH, and additives

  • Data Collection and Processing:

    • Cryo-protection optimization to minimize ice formation

    • Synchrotron radiation for high-resolution data collection

    • Process data with XDS or HKL2000 software

    • Consider phase determination methods (molecular replacement if homologous structures exist)

  • Model Building and Validation:

    • Iterative refinement with PHENIX or CCP4

    • Validate with MolProbity and other structure assessment tools

    • Relate structural features to sequence conservation

Alternative methods like cryo-electron microscopy should be considered if crystallization proves challenging.

What methods effectively identify MMAR_2288 protein-protein interactions?

A multi-technique approach is essential for validating protein-protein interactions:

  • Affinity-Based Methods:

    • His-tag pull-down using recombinant MMAR_2288 as bait

    • Co-immunoprecipitation from native M. marinum if antibodies available

    • IMAC followed by mass spectrometry to identify binding partners

  • Biophysical Characterization:

    • Surface plasmon resonance for binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Microscale thermophoresis for solution-phase interactions

  • Cellular Validation Approaches:

    • Bacterial two-hybrid screening

    • Split-protein complementation assays

    • FRET/BRET for real-time interaction monitoring

  • Computational Prediction:

    • Analyze conserved surface patches across homologs

    • Molecular docking with potential partners

    • Coevolution analysis to identify interaction interfaces

  • Validation Controls:

    • Negative controls with unrelated proteins

    • Competition assays with synthetic peptides

    • Mutational analysis of predicted interface residues

The lack of reported interaction partners in current literature suggests this remains an open research area for MMAR_2288.

How can site-directed mutagenesis inform MMAR_2288 function?

Site-directed mutagenesis provides critical insights into structure-function relationships:

  • Target Selection Strategy:

    • Identify conserved residues through sequence alignment of UPF0353 family proteins

    • Target predicted functional motifs or transmembrane regions

    • Focus on charged residues potentially involved in interactions

    • Examine predicted binding sites from computational analysis

  • Mutation Design Matrix:

Mutation TypePurposeExample Targets
Alanine scanningRemove side chain functionCharged residues, aromatics
Conservative substitutionsTest specific propertiesD→E, K→R
Cysteine introductionDisulfide mappingAdjacent helices
Deletion mutantsDomain functionTerminal regions
  • Experimental Approaches:

    • PCR-based methods (QuikChange, Q5)

    • Gibson Assembly for complex mutations

    • Express and purify mutants using standardized protocols

    • Compare stability, localization, and function to wild-type

  • Functional Assessment:

    • Phenotypic analysis in complemented strains

    • Biochemical assays for purified proteins

    • Interaction studies with identified partners

    • Structural integrity verification via circular dichroism

Statistical analysis should include appropriate controls and multiple biological replicates to ensure reproducibility .

What approaches can identify potential ligands for MMAR_2288?

Ligand identification requires systematic screening and validation:

  • Computational Screening:

    • Virtual screening against the structural model

    • Pharmacophore modeling based on binding pocket analysis

    • Molecular dynamics to identify stable binding modes

    • Ensemble docking to account for protein flexibility

  • Experimental Screening Methods:

    • Thermal shift assays for ligand-induced stability changes

    • Surface plasmon resonance with immobilized protein

    • NMR-based fragment screening

    • Native mass spectrometry for direct binding detection

  • Biological Context Screening:

    • Metabolite profiling in knockout/overexpression strains

    • Comparative metabolomics between wild-type and mutant strains

    • Activity-based protein profiling with photoreactive probes

    • In vivo crosslinking to capture transient interactions

  • Validation Strategy:

    • Dose-response curves to establish specificity

    • Competition assays with structural analogs

    • Mutational analysis of predicted binding site

    • Functional assays to determine biological relevance

Each positive hit should be validated through multiple independent techniques before concluding a genuine interaction.

How should MMAR_2288 samples be prepared for mass spectrometry?

Optimal mass spectrometry preparation for MMAR_2288 requires special considerations for membrane proteins:

  • Sample Preparation Workflow:

    • Purify protein using established protocols

    • Remove detergents using precipitation or specific cleanup kits

    • Perform in-solution or in-gel digestion with appropriate proteases

    • Extract peptides and desalt using C18 spin columns or ZipTips

  • Digestion Strategy Options:

ProteaseAdvantagesConsiderations
TrypsinStandard, predictable cleavageMay miss hydrophobic regions
ChymotrypsinComplementary to trypsinLess specific cleavage
Lys-C+TrypsinImproved digestion efficiencyTwo-step protocol required
PepsinWorks in acidic conditionsBroad specificity
  • Special Considerations for Membrane Proteins:

    • Use MS-compatible detergents (e.g., RapiGest, sodium deoxycholate)

    • Consider filter-aided sample preparation (FASP)

    • Optimize organic solvent composition for hydrophobic peptides

    • Verify extraction efficiency with known peptide standards

  • MS Analysis Parameters:

    • Use nano-LC with C18 reverse phase separation

    • Consider optimized gradients for hydrophobic peptides

    • Implement data-dependent acquisition for discovery

    • Use parallel reaction monitoring for targeted quantification

  • Data Analysis Approach:

    • Search against M. marinum database

    • Consider variable modifications (oxidation, deamidation)

    • Implement false discovery rate control (<1%)

    • Validate peptide identifications with multiple search engines

This comprehensive approach ensures reliable characterization of MMAR_2288, including detection of potential post-translational modifications.

What controls are essential for MMAR_2288 functional assays?

Robust controls are critical for reliable interpretation of functional studies:

  • Expression and Purification Controls:

    • Empty vector/untransformed host as negative control

    • Well-characterized His-tagged protein as purification control

    • Western blot verification of expected molecular weight

    • Mass spectrometry confirmation of protein identity

  • Activity Assay Controls:

    • Heat-inactivated MMAR_2288 as negative control

    • Known active enzyme in same assay system (positive control)

    • Buffer components control for non-specific effects

    • Concentration-dependent response verification

  • Binding Assay Controls:

    • Non-specific binding surface control

    • Concentration gradient to establish specificity

    • Competition with unlabeled protein

    • Irrelevant protein of similar size/properties

  • Structural Integrity Verification:

    • Circular dichroism to verify secondary structure

    • Size exclusion chromatography for aggregation assessment

    • Dynamic light scattering for monodispersity

    • Thermal shift assay for stability verification

  • Cell-Based Assay Controls:

    • Wild-type strain comparison

    • Empty vector complementation

    • Inactive mutant controls

    • Dose-response relationships

Implementation of proper randomization and blinding procedures minimizes experimental bias , while technical and biological replicates ensure reproducibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.