Recombinant Mycobacterium smegmatis GDP-mannose-dependent alpha- (1-2)-phosphatidylinositol mannosyltransferase

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pimA; MSMEG_2935; MSMEI_2861; Phosphatidyl-myo-inositol mannosyltransferase; Alpha-mannosyltransferase; GDP-mannose-dependent alpha-(1-2-phosphatidylinositol mannosyltransferase; Guanosine diphosphomannose-phosphatidyl-inositol alpha-mannosyltransferase; Phosphatidylinositol alpha-mannosyltransferase; PI alpha-mannosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)
Target Names
pimA
Target Protein Sequence
MRIGMVCPYSFDVPGGVQSHVLQLAEVLRDAGHEVSVLAPASPHVKLPDYVVSGGKAVPI PYNGSVARLRFGPATHRKVKKWIAEGDFDVLHIHEPNAPSLSMLALQAAEGPIVATFHTS TTKSLTLSVFQGILRPYHEKIIGRIAVSDLARRWQMEALGSDAVEIPNGVDVASFADAPL LDGYPREGRTVLFLGRYDEPRKGMAVLLAALPKLVARFPDVEILIVGRGDEDELREQAGD LAGHLRFLGQVDDATKASAMRSADVYCAPHLGGESFGIVLVEAMAAGTAVVASDLDAFRR VLADGDAGRLVPVDDADGMAAALIGILEDDQLRAGYVARASERVHRYDWSVVSAQIMRVY ETVSGAGIKVQVSGAANRDETAGESV
Uniprot No.

Target Background

Function
This protein is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIMs), which are crucial precursors in the synthesis of lipomannans (LM) and lipoarabinomannans (LAM). It catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the phosphatidyl-myo-inositol (PI) carrier lipid, generating phosphatidyl-myo-inositol with an alpha-1,2-linked mannose residue (PIM1). Unlike PimB, PimA cannot transfer a mannose residue to the position 6 of the phosphatidyl-myo-inositol in PIM1.
Gene References Into Functions
  1. Studies suggest that Mycobacterium smegmatis PimA (MsPimA; MSMEG_2935) exhibits relatively low mechanical stability despite possessing a beta-sheet structure predicted to unfold at significantly higher forces. PMID: 23963451
Database Links
Protein Families
Glycosyltransferase group 1 family, Glycosyltransferase 4 subfamily
Subcellular Location
Cell membrane; Peripheral membrane protein; Cytoplasmic side.

Q&A

What is GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase and what is its role in mycobacteria?

Phosphatidyl-myo-inositol mannosyltransferase A (PimA) catalyzes the transfer of mannose from GDP-mannose (GDPM) to phosphatidyl-myo-inositol (PI) to produce GDP and phosphatidyl-myo-inositol monomannoside (PIM). This initial mannosylation is a critical step in the biosynthetic pathway that ultimately produces higher PIMs, lipomannan (LM), and lipoarabinomannan (LAM) . These glycolipids and lipoglycans play crucial roles in mycobacterial virulence, survival, and antibiotic resistance. The enzyme is particularly important for the pathogenicity of mycobacterial species, including Mycobacterium tuberculosis, where its homolog MtPMT (Rv1002c) is essential for virulence .

How does the structure of PimA relate to its function?

PimA has been shown to adopt two distinct conformations—"open" and "closed"—during catalysis. Molecular dynamics (MD) simulations indicate that PimA is least dynamic (most stable) when bound to both GDPM and PI simultaneously . The enzyme becomes more rigid when transitioning to a closed conformation during substrate binding, which facilitates the mannose transfer reaction. Several structural elements have been identified as critical for function, including the loop formed by residues 59-70, which plays an important role in substrate binding and product release .

What experimental systems are available for studying the enzyme?

Several experimental approaches have been developed to study this enzyme:

  • Recombinant expression systems: The enzyme can be expressed in various bacterial hosts for purification and subsequent in vitro studies.

  • Target-based phenotypic assays: A non-pathogenic M. smegmatis strain can be used to assess mannosyltransferase activity in bacteria. This system allows for the evaluation of enzyme activity in a cellular context while avoiding the hazards of working with pathogenic mycobacteria .

  • Intact protein mass spectrometry: This technique can be used to quantitatively evaluate enzyme activity by detecting the addition of mannose residues to substrate proteins .

  • Molecular dynamics (MD) simulations: These computational methods have been successfully employed to understand the conformational changes and interactions between the enzyme and its substrates/products .

What are the key residues involved in substrate binding and catalysis?

Molecular dynamics studies and structural analyses have identified several critical residues in PimA that participate in substrate binding and catalysis:

  • Key catalytic residues: Y9, P59, R68, L69, N97, R196, R201, K202, and R228 have been shown to play significant roles in the mannosyltransferase activity .

  • GDP/GDPM binding site: The binding pocket for the nucleotide portion of the substrate involves multiple conserved residues that stabilize the donor through hydrogen bonding and electrostatic interactions.

  • PI/PIM binding region: The loop formed by residues 59-70 and the α-helical residues 73-86 are particularly important for interacting with the lipid substrates and products .

  • Residue R201 flexibility: This residue shows increased flexibility in the presence of GDPM or PI, suggesting it undergoes important conformational changes during catalysis. The guanidinium group of R201 may interact with either the phosphate group of PI or form hydrogen bonds with the hydroxyl groups of the inositol moiety .

What is the proposed mechanism for mannose transfer?

Based on MD simulations and binding energy analyses, the following mechanism has been proposed:

  • GDPM is likely recruited to the enzyme first, as indicated by binding energy calculations.

  • The binding of GDPM is stabilized by the subsequent incorporation of PI.

  • The enzyme transitions from an "open" to a "closed" conformation upon binding both substrates.

  • After mannose transfer, PIM is probably released first, followed by GDP.

  • The lower binding energy (ΔGbind) between the enzyme and GDP compared to GDPM may drive the reaction forward .

LigandΔGbind from MMGBSA analyses (kcal/mol)Kd (μM)ΔGbind = -RT ln(Kd) (kcal/mol)
GDPM-26.63 ± 9.940.23-0.87
GDP-36.10 ± 10.170.03-2.08
PI-21.81 ± 9.472.27-0.48
PIM-19.45 ± 6.29NANA

This table shows that GDP has a stronger binding affinity to PimA than GDPM, which may help drive the reaction forward .

How do conformational changes in the enzyme contribute to catalysis?

Root-mean-square deviation (RMSD), radius of gyration (Rg), and principal component analysis (PCA) from MD simulations reveal that:

These findings indicate that substrate binding induces significant conformational changes that stabilize the enzyme-substrate complex and position the reactive groups for optimal catalysis.

What approaches can be used to design inhibitors targeting the mannosyltransferase?

Several strategies can be employed to develop specific inhibitors:

  • Structure-based design: Using the available structural information, especially the binding modes of substrates and products, to design compounds that can compete with natural substrates.

  • Target-based phenotypic screening: A "target-based" phenotypic assay for this enzyme has been developed in M. smegmatis, which can assess O-mannosyltransferase activity in bacteria. This approach has already identified two compounds containing pyrrole analogous rings as significant inhibitors of MtPMT activity .

  • Transition state mimics: Designing molecules that mimic the transition state of the mannose transfer reaction.

  • Allosteric modulators: Targeting regions of the enzyme involved in conformational changes, such as the loop residues 59-70 and the α-helical residues 73-86 .

How can the enzymatic activity be measured in vitro?

Several methods can be employed to measure the activity of GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase:

  • Radioactive assays: Using radiolabeled GDP-mannose to track the transfer of mannose to PI.

  • Tricine-SDS-PAGE: This technique can be used to detect the addition of mannose to peptide substrates by observing mobility shifts .

  • Liquid chromatography-mass spectrometry (LC-MS): LC-MS can demonstrate the covalent attachment of a mannose unit to a substrate by detecting the corresponding mass increase .

  • Intact protein mass spectrometry: This approach can be used to quantitatively evaluate the mannosylation of protein substrates .

  • Fluorescent assays: Using synthetic, fluorescently labeled peptides as acceptor substrates can facilitate high-throughput screening of enzyme activity .

What are the optimal conditions for expressing and purifying recombinant PimA?

For successful expression and purification of active recombinant PimA:

  • Expression system: The enzyme can be expressed in E. coli or mycobacterial expression systems like M. smegmatis.

  • Buffer conditions: Unlike some glycosyltransferases, PimA does not appear to require divalent metal ion cofactors such as Mn²⁺ or Mg²⁺ for activity . Therefore, metal ion supplementation is not necessary, and EDTA can be included in buffers without affecting activity.

  • Purification tags: Histidine tags are commonly used for affinity purification of recombinant enzymes and do not generally interfere with PimA activity.

  • Storage conditions: The purified enzyme should be stored in a stabilizing buffer, typically containing a reducing agent to maintain cysteine residues in a reduced state, and glycerol to prevent freeze-thaw damage.

How can molecular dynamics simulations be effectively used to study this enzyme?

MD simulations have proven valuable for understanding the dynamics and mechanisms of PimA:

What are the current limitations in studying the enzyme and how might they be addressed?

Current challenges in studying this enzyme include:

  • Membrane association: The enzyme is naturally associated with the membrane, which complicates structural and functional studies. Using detergents or nanodiscs might help maintain the enzyme in a more native-like environment.

  • Complex substrate requirements: The natural substrate, PI, is a lipid that requires special handling due to its hydrophobicity. Synthetic analogs or simplified substrates could be developed to facilitate in vitro studies.

  • Establishing physiological relevance: Correlating in vitro findings with in vivo function remains challenging. Genetic approaches like site-directed mutagenesis of key residues identified in structural studies can help bridge this gap.

How do mutations in key residues affect enzyme function and substrate specificity?

Based on structural and MD studies, several residues have been identified as critical for PimA function. Site-directed mutagenesis can be used to:

  • Validate catalytic residues: Mutations in residues Y9, P59, R68, L69, N97, R196, R201, K202, and R228 would be expected to significantly impact enzyme activity .

  • Alter substrate specificity: Mutations in the residues that interact with PI/PIM might modify the enzyme's preference for different lipid substrates.

  • Investigate conformational dynamics: Mutations in loop regions involved in the "open to closed" transition could provide insights into the importance of these conformational changes for catalysis.

What potential exists for developing selective inhibitors as research tools or therapeutics?

The development of selective inhibitors offers several opportunities:

  • Chemical probes: Selective inhibitors can serve as valuable tools to study the role of this enzyme in mycobacterial physiology and pathogenesis.

  • Drug development: Since the enzyme is crucial for mycobacterial virulence, inhibitors could potentially be developed into novel anti-tuberculosis drugs. A screening of a limited library has already identified compounds with pyrrole analogous rings as significant inhibitors .

  • Combination therapy: Inhibitors targeting this enzyme might synergize with existing antibiotics, potentially overcoming some forms of drug resistance.

  • Selective toxicity: As this enzyme is absent in humans, targeting it might provide selective toxicity against mycobacteria while minimizing side effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.