Recombinant Mycobacterium smegmatis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mycobacterium smegmatis NADH-Quinone Oxidoreductase Subunit K (nuoK)

Recombinant Mycobacterium smegmatis nuoK is a bioengineered protein representing subunit K of Complex I (NADH:menaquinone oxidoreductase), a critical component of the mycobacterial electron transport chain. This subunit is part of the nuo operon (Rv3145–Rv3158 in M. tuberculosis), which encodes the proton-pumping Type I NADH dehydrogenase (NDH-1) complex. The recombinant form is produced in heterologous systems (e.g., Escherichia coli) for structural, functional, and therapeutic studies .

Functional Significance

  • Electron Transfer: Facilitates NADH oxidation and quinone reduction via its role in the hydrophilic domain.

  • Proton Pumping: Contributes to proton translocation across the membrane, generating an electrochemical gradient for ATP synthesis .

  • Regulatory Interactions: Associates with orphan response regulators (e.g., MSMEG_2064), modulating Complex I activity under stress conditions .

Production Methods

ParameterDetailsSource
Host SystemE. coli (commonly used for high-yield expression)
TagN-terminal His-tag (facilitates affinity purification)
Purity>85% (SDS-PAGE confirmed)
StorageLyophilized or liquid form at -20°C/-80°C; avoid repeated freeze-thaw cycles

Key Challenges

  • Partial Expression: Recombinant nuoK is often produced as a truncated protein (e.g., 1–99 amino acids), limiting full structural analysis .

  • Lipid Binding: The native mycobacterial membrane lipid acyl phosphatidylinositol dimannoside is absent in heterologous systems, potentially altering functionality .

Functional Studies

ApplicationKey FindingsSource
Complex I AssemblyMSMEG_2064 (a regulatory subunit) interacts with nuoK to stabilize the NADH-binding site
Oxidative Stress ResponseΔmsmeg_2064 mutants show reduced viability under reactive nitrogen species
Drug TargetingMutations in NDH-1 subunits (e.g., nuoG) attenuate M. tuberculosis virulence

Biochemical Insights

  • Kinetic Mechanism: NuoK-containing Complex I follows a ping-pong mechanism during quinone reduction, distinct from sequential substrate binding .

  • Substrate Specificity: Menaquinone (MQ) binds more extensively to Complex I than ubiquinone (UQ), mediated by interactions with a catalytic histidine residue .

Comparative Analysis with Other NADH Dehydrogenases

ParameternuoK (NDH-1)NDH-2 (ndh)
Proton PumpingYes (proton translocation)No
EssentialityDispensable in vitroEssential for growth
Drug TargetsLimited (non-essential)High potential (species-specific)

Future Directions and Challenges

  • Full-Length Production: Overcoming truncation limitations to study native interactions.

  • Therapeutic Implications: Exploring nuoK as a biomarker or target for antitubercular drugs, given its role in stress adaptation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; MSMEG_2053; MSMEI_2008; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)
Target Names
nuoK
Target Protein Sequence
MNPDNYLYLSALLFTIGAAGVLLRRNAIVMFMCVELMLNAANLAFVNFSRMHGQLDGQVV AFFTMVVAACEVVVGLAIIMAIFRTRRSASVDDANLLKH
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. The primary electron acceptor for this enzyme in this species is thought to be a menaquinone. This process is coupled with proton translocation, where four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred. Consequently, the redox energy is conserved in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mycobacterium smegmatis and why is it valuable for recombinant protein research?

Mycobacterium smegmatis is a non-pathogenic mycobacterium species with genetic similarities to Mycobacterium tuberculosis and other clinically relevant mycobacteria. It offers distinct advantages as a research model because:

  • It propagates approximately 10 times faster than Bacillus Calmette-Guérin (BCG), significantly reducing experimental timeframes

  • It is generally safe for laboratory manipulation and considered harmless to immunocompetent individuals

  • It is amenable to genetic manipulation and protein expression techniques

  • Unlike pathogenic mycobacteria that survive by inhibiting phagosome maturation, M. smegmatis is rapidly killed by phagosomal proteases, making it safer for research purposes

These characteristics make M. smegmatis an excellent surrogate system for studying mycobacterial proteins, including membrane components like NADH-quinone oxidoreductase subunit K (nuoK).

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its role in mycobacterial physiology?

NADH-quinone oxidoreductase subunit K (nuoK) is one of the 14 subunits (NuoA-NuoN) that compose the Type I NADH dehydrogenase complex (NDH-1, also called the Nuo complex) in mycobacteria. This complex spans Rv3145-Rv3158 in the M. tuberculosis genome . The nuoK subunit contributes to:

While nuoK itself is part of a larger complex, the Nuo complex is one of three NADH dehydrogenases in mycobacteria, alongside the non-proton-pumping Type II enzymes Ndh and NdhA .

What are the fundamental differences between NADH dehydrogenase complexes in mycobacteria?

Mycobacteria possess three distinct membrane-bound NADH dehydrogenase complexes that differ significantly in structure and function:

NADH DehydrogenaseTypeProton TranslocationSubunit CompositionFunction
Nuo (contains nuoK)Type IYes14 subunits (NuoA-NuoN)Oxidizes NADH to NAD+, transfers electrons to menaquinone, pumps protons
NdhType IINoSingle subunitOxidizes NADH to NAD+, transfers electrons to menaquinone
NdhAType IINoSingle subunitOxidizes NADH to NAD+, transfers electrons to menaquinone

This diversity provides mycobacteria with metabolic flexibility and respiratory chain plasticity. Unlike the multi-subunit Nuo complex (which includes nuoK), the Type II enzymes do not contribute directly to the proton gradient but still participate in NADH oxidation .

How do deletions of NADH dehydrogenase subunits affect Mycobacterium growth and virulence?

Genetic deletion studies have revealed complex and sometimes unexpected phenotypes associated with NADH dehydrogenase mutations:

  • Complete deletion of the Nuo complex (including nuoK) has minimal effect on M. tuberculosis growth in vitro or in vivo

  • Deletion of ndh results in growth impairment, increased susceptibility to oxidative stress, and reduced virulence in vivo

  • When NdhA is the only NADH dehydrogenase present (in Δndh ΔnuoAN mutants), the most severe growth defects occur both in vitro and in vivo

  • When Ndh is the only NADH dehydrogenase present (in ΔndhA ΔnuoAN mutants), no growth defects are observed

These observations suggest that while the Nuo complex (containing nuoK) is not essential when other NADH dehydrogenases are present, it plays a compensatory role when Ndh is absent. The severe attenuation of the Δndh ΔnuoAN double mutant compared to the Δndh single mutant indicates that Nuo may significantly contribute to M. tuberculosis virulence under certain conditions .

What structural and functional aspects of nuoK are important for recombinant expression?

When expressing recombinant nuoK, several structural and functional considerations are critical:

  • Membrane localization: nuoK is an integral membrane protein that requires appropriate hydrophobic regions for correct insertion

  • Complex assembly: Since nuoK functions as part of the 14-subunit Nuo complex, isolated expression may affect folding and function

  • Post-translational modifications: Any native modifications required for function must be considered

  • Expression system compatibility: The codon usage and membrane composition of the expression system affect successful production

Researchers often employ specialized expression systems that accommodate membrane proteins, such as bacterial surface display techniques where membrane proteins can be fused with carrier proteins that facilitate proper localization, similar to the approach used for displaying SARS-CoV-2 antigens in M. smegmatis .

How does the NADH/NAD+ ratio influence mycobacterial metabolism and drug susceptibility?

The NADH/NAD+ ratio is a critical metabolic parameter in mycobacteria with significant implications:

  • Deletion of ndh in M. tuberculosis increases the NADH/NAD+ ratio 3-4 fold compared to wild-type strains

  • Elevated NADH levels can competitively inhibit binding of INH-NAD adducts to InhA, potentially conferring isoniazid resistance

  • Species-specific differences exist: M. smegmatis ndh mutants show high-level isoniazid resistance (20-fold) with NADH concentrations approaching 2 mM, while M. tuberculosis ndh mutants show only low-level resistance (2-4 fold) with NADH levels not exceeding 0.3 mM

This relationship between NADH metabolism and drug susceptibility highlights the potential importance of nuoK and other NADH dehydrogenase components in antimicrobial therapy and resistance mechanisms.

What are the optimal methods for generating recombinant Mycobacterium smegmatis expressing nuoK?

For successful generation of recombinant M. smegmatis expressing nuoK, consider the following methodological approach:

  • Vector selection: Choose mycobacterial-compatible shuttle vectors with appropriate promoters and selection markers

  • Fusion strategy: Consider fusing nuoK with a carrier protein to facilitate expression and detection

    • The PE_PGRS33 protein has been successfully used as a transportation component for surface display of recombinant proteins in mycobacteria

  • Transformation protocol:

    • Prepare electrocompetent M. smegmatis cells from mid-log phase cultures

    • Use electroporation (typically 2.5 kV, 25 μF, 1000 Ω) for DNA transfer

    • Recover cells in rich media before plating on selective media

  • Verification of expression:

    • Western blotting of subcellular fractions

    • Surface display can be confirmed through cell wall fraction analysis

    • Immunofluorescence microscopy for spatial localization

The success of recombinant expression should be assessed through both protein detection techniques and functional assays measuring NADH dehydrogenase activity.

How can researchers accurately measure NADH dehydrogenase activity in recombinant M. smegmatis expressing nuoK?

Measuring NADH dehydrogenase activity requires careful experimental design:

  • Membrane isolation protocol:

    • Harvest cells in late-logarithmic phase

    • Disrupt cells by sonication or mechanical methods

    • Differentially centrifuge to isolate membrane fractions

  • Spectrophotometric assay:

    • Monitor NADH oxidation at 340 nm

    • Use appropriate electron acceptors (menaquinone analogs)

    • Include controls with specific inhibitors to distinguish between different NADH dehydrogenase types

  • Data recording template:

SampleNADH Concentration (μM)Initial Rate (ΔA340/min)Specific Activity (μmol/min/mg)Inhibitor Sensitivity (%)
Wild-type
Recombinant nuoK
Control 1
Control 2
  • Analysis considerations:

    • Plot activity data with independent variables (e.g., substrate concentration) on the x-axis and dependent variables (e.g., enzyme activity) on the y-axis3

    • Perform replicate measurements to establish statistical significance

    • Calculate specific activity normalized to protein content

This methodological approach provides quantitative assessment of recombinant nuoK functionality within the native respiratory chain.

What approaches can be used to study the membrane topology and interactions of recombinant nuoK in M. smegmatis?

Understanding nuoK's topology and interactions requires specialized techniques:

  • Cysteine scanning mutagenesis:

    • Systematically replace residues with cysteine

    • Use membrane-impermeable sulfhydryl reagents to probe accessibility

    • Map transmembrane segments and exposed regions

  • Protein crosslinking:

    • Apply chemical crosslinkers of varying lengths

    • Identify interaction partners through mass spectrometry

    • Map proximity relationships within the Nuo complex

  • Fluorescence resonance energy transfer (FRET):

    • Generate fluorescent protein fusions

    • Measure energy transfer between labeled components

    • Quantify interaction distances in live cells

  • Membrane subfractionation protocol:

    • Isolate plasma membrane

    • Separate using sucrose gradient centrifugation

    • Analyze nuoK distribution across fractions

These approaches together provide structural insights that complement functional studies of recombinant nuoK in M. smegmatis.

How can researchers identify and resolve contradictions in experimental data related to recombinant nuoK?

When facing contradictory experimental results, implement this systematic approach:

  • Classify contradiction types:

    • Numerical mismatches (e.g., different activity measurements)

    • Structural contradictions (e.g., different topology models)

    • Functional contradictions (e.g., different phenotypes)

  • Resolution methodology:

    • Examine experimental conditions for differences that might explain discrepancies

    • Assess statistical significance of contradictory results

    • Consider genetic background effects (strain differences)

    • Evaluate potential post-translational modifications

  • Comprehensive data integration:

    • Cross-validate using multiple experimental techniques

    • Develop testable hypotheses that might explain contradictions

    • Design experiments specifically to address discrepancies

  • Documentation template for contradiction resolution:

Contradictory FindingSourcePotential ExplanationValidation ExperimentResolution
Finding 1 vs. Finding 2
Finding 3 vs. Finding 4

This structured approach helps researchers resolve data contradictions through methodical analysis rather than selectively discarding inconvenient results .

What statistical approaches are most appropriate for analyzing phenotypic differences in recombinant M. smegmatis expressing nuoK?

Selecting appropriate statistical methods is critical for robust data interpretation:

  • Growth curve analysis:

    • Use nonlinear regression to fit growth models

    • Compare growth parameters (lag phase, doubling time, maximum OD)

    • Apply repeated measures ANOVA for time-course data

  • Stress response experiments:

    • Use survival ratios under stress conditions

    • Apply appropriate transformations for non-normally distributed data

    • Include multiple time points to capture dynamic responses

  • Gene expression studies:

    • Normalize to appropriate reference genes

    • Apply statistical corrections for multiple comparisons

    • Use hierarchical clustering to identify co-regulated genes

  • Recommended statistical workflow:

    • Test assumptions of normality and homogeneity of variance

    • Select parametric or non-parametric tests accordingly

    • Report effect sizes alongside p-values

    • Present both raw data and statistical summaries

These approaches ensure that phenotypic differences attributed to recombinant nuoK expression are statistically robust and biologically meaningful.

How can researchers differentiate between direct and indirect effects of nuoK expression on mycobacterial physiology?

Distinguishing direct from indirect effects requires careful experimental design:

  • Genetic complementation studies:

    • Express wild-type or mutant nuoK in knockout backgrounds

    • Compare phenotype restoration across multiple parameters

    • Use inducible expression systems to establish dose-response relationships

  • Temporal analysis:

    • Monitor changes immediately following nuoK induction

    • Track metabolic and transcriptional shifts over time

    • Early changes are more likely direct effects

  • Metabolic profiling:

    • Measure NADH/NAD+ ratios and related metabolites

    • Create metabolic flux maps using labeled substrates

    • Identify pathways directly impacted by altered NADH metabolism

  • Control experiments with other Nuo subunits:

    • Compare phenotypes with other subunit manipulations

    • Identify nuoK-specific versus general Nuo complex effects

This multi-faceted approach helps establish causality rather than mere correlation between nuoK expression and observed phenotypes.

How can recombinant M. smegmatis expressing nuoK be developed as a vaccine vector platform?

The development of M. smegmatis as a vaccine vector involves several considerations:

  • Safety profile assessment:

    • While M. smegmatis is generally safe for immunocompetent individuals, attenuated strains have been developed for enhanced safety

    • The rapid killing of M. smegmatis in phagosomes provides an intrinsic safety feature

  • Antigen display strategy:

    • Surface display using fusion partners (like PE_PGRS33) can present antigens in their native conformation

    • The nuoK complex could potentially be engineered to carry antigenic determinants

  • Immune response characterization:

    • M. smegmatis-based vaccines can effectively elicit antigen-specific T cell responses

    • They can induce subsets of central memory CD4+ and CD8+ T cells

  • Comparative advantages:

    • Faster growth than BCG (10× faster) reduces production time

    • Genetic tractability allows precise antigen engineering

    • Natural adjuvant properties of mycobacterial cell wall components

This approach has shown promise with SARS-CoV-2 antigens, suggesting potential applications for other pathogens requiring strong cellular immunity .

What methods can be used to evaluate the immunogenicity of recombinant M. smegmatis expressing nuoK?

Comprehensive immunogenicity assessment requires multiple complementary approaches:

  • In vitro evaluation:

    • Infect dendritic cells and macrophages (e.g., RAW264.7, DC2.4) with recombinant strains

    • Measure cytokine production using ELISA or multiplex assays

    • Assess antigen presentation to T cell hybridomas

  • In vivo immune response analysis:

    • Immunize with standardized doses (e.g., 106 cells)

    • Collect samples at multiple timepoints post-immunization

    • Perform flow cytometry to quantify T cell subsets:

      • Central memory CD4+ T cells (CD44hiCD62Lhi)

      • Effector memory CD8+ T cells (CD44hiCD62Llo)

  • Challenge studies:

    • Immunize animals followed by pathogen challenge

    • Compare protection levels between different constructs

    • Assess survival, bacterial/viral load, and immune correlates

  • Data representation:

    • Present flow cytometry data as percentage of parent populations

    • Compare immune responses between different constructs using appropriate statistical tests

    • Correlate specific immune components with protection in challenge models

These methodologies provide a comprehensive assessment of both the magnitude and quality of immune responses generated by recombinant M. smegmatis vaccine candidates.

What are the emerging techniques for studying protein-protein interactions involving nuoK in the respiratory chain?

Advanced techniques for investigating nuoK interactions include:

  • Cryo-electron microscopy:

    • Near-atomic resolution structural analysis of membrane protein complexes

    • Visualization of nuoK within the intact Nuo complex

    • Identification of conformational changes during electron transport

  • Proximity-dependent biotin labeling:

    • TurboID or BioID fusion to nuoK

    • Identification of proximal proteins in the native membrane environment

    • Temporal mapping of dynamic interaction networks

  • Single-molecule tracking:

    • Fluorescent labeling of nuoK

    • Real-time visualization of complex assembly and dynamics

    • Quantification of diffusion coefficients and interaction kinetics

  • Hydrogen-deuterium exchange mass spectrometry:

    • Mapping of solvent-accessible regions

    • Identification of conformational changes upon substrate binding

    • Detection of interface regions between nuoK and other subunits

These emerging technologies provide unprecedented insights into the structural and functional integration of nuoK within the mycobacterial respiratory apparatus.

How might nuoK function be leveraged for developing novel anti-mycobacterial strategies?

The potential of nuoK as a therapeutic target can be explored through:

  • Structure-based inhibitor design:

    • Target nuoK-specific regions within the Nuo complex

    • Rational design of compounds that disrupt critical interactions

    • Screen for molecules that selectively inhibit mycobacterial but not human NADH dehydrogenases

  • Combination therapy approaches:

    • Leverage the relationship between NADH dehydrogenase function and isoniazid susceptibility

    • Develop nuoK inhibitors that potentiate existing antibiotics

    • Target metabolic vulnerabilities created by nuoK inhibition

  • Heterologous expression systems:

    • Express mycobacterial nuoK in model organisms

    • Establish high-throughput screening platforms

    • Identify species-specific inhibitors with therapeutic potential

  • Experimental validation workflow:

    • In vitro enzyme inhibition

    • Whole-cell activity against M. smegmatis and M. tuberculosis

    • Cytotoxicity testing against mammalian cells

    • In vivo efficacy in animal models

This multi-faceted approach could lead to new therapeutic strategies targeting mycobacterial bioenergetics through nuoK modulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.