Recombinant Mycobacterium smegmatis Phosphatidylinositol mannoside acyltransferase (MSMEG_2934)

Shipped with Ice Packs
In Stock

Description

General Information

Mycobacterium smegmatis Phosphatidylinositol mannoside acyltransferase, specifically MSMEG_2934, is an enzyme involved in the biosynthesis of phosphatidylinositol mannosides (PIMs) . PIMs are essential structural components of the mycobacterial cell envelope and play a role in host-pathogen interactions during infection, also serving as a base for synthesizing other molecules with immunomodulatory properties, such as lipoarabinomannan and lipomannan . MSMEG_2934 is an ortholog of Mycobacterium tuberculosis acyltransferase Rv2611c .

Structure and Function

Proteins are composed of amino acids linked together in a specific sequence, known as the primary structure, which dictates the three-dimensional conformation of the folded protein and determines its function . The MSMEG_2934 gene encodes the MSMEG_2934 protein, which functions as an acyltransferase . Specifically, MSMEG_2934 attaches an acyl group to the position-6 of the 2-linked mannosyl residue of the phosphatidylinositol mannoside anchor .

Research and Findings

  • Purification and Characterization Biochemical characterization of acyltransferase Rv2611 had been incomplete due to the difficulty of obtaining the pure protein . MSMEG_2934, the ortholog of Rv2611c from M. smegmatis mc 2155, has been overexpressed and purified using a mycobacterial pJAM2 expression system, which allowed confirmation of its in vitro acyltransferase activity and establishment of its substrate specificity .

  • In Source Decay (ISD) characterization The purified MSMEG_2934 protein has been analyzed using In Source Decay (ISD) characterization . The protein was mixed with 1,5-diaminonaphthalene in TA50 (0.1% trifluoroacetic acid: acetonitrile, 1:1) and spotted on the MALDI target plate . N- and C-terminal fragments were identified using BioTools software (Bruker) using the theoretical sequence of recombinant MSMEG_2934 protein .

Role in Mycobacterium smegmatis

Mycobacterium smegmatis is a nonpathogenic species of the genus Mycobacterium that can be easily manipulated to produce recombinant bacteria . Due to this, it is widely used as a live vaccine against cancer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
patA; MSMEG_2934; MSMEI_2860; Phosphatidylinositol mannoside acyltransferase; PIM acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)
Target Names
MSMEG_2934
Target Protein Sequence
MTLSGRIPLGGQVTDLGYAAGWRLVRAMPEAMAQGVFGAGARYAARNGGPEQLRRNLARV VGKPPADVPDDLIRASLASYARYWREAFRLPAMDHGRLGEQLDVIDIDHLWSALDAGRGA VLALPHSGNWDMAGVWLVQNYGPFTTVAERLKPESLYRRFVEYRESLGFEVLPLTGGERP PFEVLAERLTDNRPICLMAERDLTRSGVQVDFFGEATRMPAGPAKLAIETGAALFPVHCW FEGDGWGMRVYPELDTSSGDVTAITQALADRFAANIATYPADWHMLQPQWIADLSDERRA RLGT
Uniprot No.

Target Background

Function
This recombinant *Mycobacterium smegmatis* Phosphatidylinositol mannoside acyltransferase (MSMEG_2934) catalyzes the transfer of a palmitoyl moiety from palmitoyl-CoA to the 6-position of the mannose ring linked to the 2-position of myo-inositol in phosphatidyl-myo-inositol monomannoside (PIM1) or dimannoside (PIM2).
Gene References Into Functions
  1. MSMEG_2934 facilitates palmitoyl group attachment to phosphatidylinositol dimannoside. [PMID: 24810911](https://www.ncbi.nlm.nih.gov/pubmed/24810911)
Database Links
Protein Families
LpxL/LpxM/LpxP family
Subcellular Location
Cell inner membrane; Peripheral membrane protein; Cytoplasmic side.

Q&A

What is MSMEG_2934 and what is its functional role?

MSMEG_2934 is an acyltransferase enzyme found in Mycobacterium smegmatis that plays a critical role in mycobacterial cell wall biosynthesis. It functions specifically in the attachment of an acyl group to position-6 of the 2-linked mannosyl residue of the phosphatidylinositol mannoside (PIM) anchor . This protein is particularly significant because it is orthologous to Rv2611c from Mycobacterium tuberculosis, the causative agent of tuberculosis . Although this enzyme's function was annotated a decade ago, complete biochemical characterization was hindered by challenges in obtaining the purified protein until relatively recently .

The acyltransferase activity of MSMEG_2934 is essential in the biosynthesis of mannosylated glycoconjugates, which are key components of the mycobacterial cell envelope. These structures contribute to the characteristic impermeability and drug resistance of mycobacterial cell walls, making MSMEG_2934 a protein of significant research interest in the field of mycobacterial pathogenesis and drug development.

How does MSMEG_2934 relate to Mycobacterium tuberculosis research?

MSMEG_2934 serves as a valuable model for studying mycobacterial cell wall biosynthesis because it is the ortholog of Rv2611c from Mycobacterium tuberculosis . M. smegmatis is frequently used as a non-pathogenic model organism in tuberculosis research due to its faster growth rate and lower biosafety requirements compared to M. tuberculosis.

The study of MSMEG_2934 provides insights into the function of its ortholog in M. tuberculosis, potentially contributing to our understanding of cell wall biosynthesis in this major human pathogen. Since the mycobacterial cell wall is a target for many anti-tuberculosis drugs, characterizing enzymes involved in its synthesis, like MSMEG_2934, may aid in the identification of novel drug targets or the optimization of existing therapeutic approaches.

What expression systems are most effective for producing recombinant MSMEG_2934?

The mycobacterial pJAM2 expression system has been successfully employed for the overexpression of MSMEG_2934 . This expression system is particularly suitable for mycobacterial proteins as it provides the appropriate cellular environment for proper folding and post-translational modifications. The protocol typically involves:

  • PCR amplification of the msmeg_2934 gene from M. smegmatis mc²155 DNA using specific primers (e.g., forward primer AT.fw-1: 5′-AAGGGATCCGTGACGGACTTGGGGTATGCGG-3′ and reverse primer AT.rv: 5′-GGCTCTAGAGGTTCCCAACCGTGCGCGGC-3′)

  • Cloning the PCR product into the E. coli-mycobacterial shuttle pJAM2 vector between BamHI and XbaI restriction sites

  • Transformation into the host organism for protein expression

Additionally, recombinant MSMEG_2934 can be produced with a His-tag, facilitating subsequent purification steps . While the pJAM2 system has proven effective, researchers should consider that expression conditions may need optimization based on specific experimental requirements and the desired protein yield.

What are the optimal conditions for purifying MSMEG_2934?

Purification of MSMEG_2934 has been successfully achieved using Co²⁺ affinity chromatography, which yields highly purified protein suitable for biochemical characterization . The detailed purification protocol includes:

  • Cell lysis by sonication in an appropriate buffer (e.g., buffer A)

  • Release of membrane-associated MSMEG_2934 using 2 mM CHAPS, 300 mM NaCl, and 10% (v/v) glycerol

  • Removal of cellular debris by centrifugation (11,000 × g, 4°C, 20 minutes)

  • Addition of imidazole to a final concentration of 10 mM

  • Binding to TALON Co²⁺ affinity resin with gentle stirring (4°C, 1 hour)

  • Column washing with 10 mM imidazole in buffer BE (20 mM Tris-HCl, pH 7.5, 300 mM NaCl, 10% glycerol)

  • Elution using a step-wise gradient of 50, 200, and 1,000 mM imidazole

  • Dialysis against buffer A and storage in buffer A containing 10% (v/v) glycerol at -20°C

This protocol typically yields approximately 1 mg of pure protein per gram of cells (wet weight) . The purity of the isolated protein can be assessed using SDS-PAGE, and additional characterization can be performed using techniques such as In-Source Decay (ISD) mass spectrometry to confirm the identity of the purified protein .

How can the enzymatic activity of MSMEG_2934 be assayed in vitro?

Two complementary approaches have been developed to assess the enzymatic activity of purified MSMEG_2934:

  • In situ substrate generation assay:

    • This assay uses membrane proteins from M. smegmatis mc²155 incubated with GDP-[¹⁴C]mannose to produce putative MSMEG_2934 substrates in situ

    • Addition of mannosyltransferase PimA from M. smegmatis mc²155 enhances [¹⁴C]PIM₁ synthesis

    • Reaction components include:

      • 10 μg purified MSMEG_2934

      • 1.2 μg purified PimA SM

      • 250 μg membrane proteins from M. smegmatis

      • 0.1 μCi GDP-[¹⁴C]mannose (55 mCi/mmol)

      • 0.12 mM palmitoyl-CoA in DMSO (2% v/v final concentration)

      • 62 μM ATP

      • 10 mM MgCl₂

      • Buffer A (total volume 50 μl)

    • After incubation (37°C, 1 hour), reaction products are extracted with CHCl₃/CH₃OH (2:1) and analyzed by TLC followed by autoradiography

  • Substrate specificity assay:

    • This alternative approach employs purified MSMEG_2934 and a range of putative lipid substrates

    • Reaction components include:

      • 650 dpm radioactive substrate

      • 10 μg purified MSMEG_2934

      • 0.12 mM palmitoyl-CoA in DMSO (2% v/v final concentration)

      • 62 μM ATP

      • 10 mM MgCl₂

      • Buffer A (total volume 50 μl)

    • After incubation (37°C, 1 hour), samples are processed and analyzed similarly to the first assay

    • Quantification of substrate and product bands can be performed using IMAGEJ software

These assays enable researchers to monitor the acyltransferase activity of MSMEG_2934 and determine its substrate specificity, providing valuable insights into its biochemical function.

What are the key substrates and products in MSMEG_2934 reactions?

MSMEG_2934 functions as an acyltransferase that catalyzes the transfer of an acyl group (typically palmitoyl) to position-6 of the 2-linked mannosyl residue of phosphatidylinositol mannoside (PIM) . The key components of this reaction include:

Substrates:

  • Phosphatidylinositol mannosides (PIMs), specifically the monomannosylated form (PIM₁)

  • Palmitoyl-CoA (as the acyl donor)

  • ATP (required for energy)

  • Mg²⁺ (as a cofactor)

Products:

  • Acylated phosphatidylinositol mannosides (Ac₁PIM₁)

The reaction can be monitored using radioactively labeled substrates (e.g., GDP-[¹⁴C]mannose as a precursor for generating [¹⁴C]PIM₁), followed by separation of reaction products using thin-layer chromatography (TLC) and detection by autoradiography . This experimental approach allows researchers to assess the enzymatic activity of MSMEG_2934 and investigate factors that may influence its catalytic efficiency.

What controls should be included when designing experiments involving MSMEG_2934?

When designing experiments to study MSMEG_2934, researchers should include several types of controls to ensure reliable and interpretable results:

  • Negative controls:

    • Reaction mixtures without MSMEG_2934 to assess background activity or non-enzymatic reactions

    • Heat-inactivated MSMEG_2934 to confirm that observed activity is due to the active enzyme

    • Reactions without key substrates (e.g., palmitoyl-CoA) to verify substrate requirements

  • Positive controls:

    • Known acyltransferases with similar functions, if available

    • Previously characterized batches of MSMEG_2934 with confirmed activity

  • Validation controls:

    • Multiple independent protein preparations to ensure reproducibility

    • Concentration-dependent assays to confirm enzyme kinetics

    • Time-course experiments to establish reaction linearity

For experiments investigating variables that might affect MSMEG_2934 activity, researchers should clearly define their experimental variables following established principles of experimental design . This includes:

  • Independent variables: The factors being manipulated (e.g., substrate concentration, temperature, pH)

  • Dependent variables: The measured outcomes (e.g., reaction rate, product formation)

  • Control variables: Factors kept constant across experimental conditions

  • Confounding variables: Factors that might unintentionally influence results

By carefully controlling these variables and including appropriate controls, researchers can generate reliable data on MSMEG_2934 function and minimize experimental artifacts.

How should contradictory results in MSMEG_2934 research be addressed?

When researchers encounter contradictory results in studies involving MSMEG_2934, a systematic approach to resolving these discrepancies is essential. Based on principles for addressing contradictions in biomedical literature, researchers should:

  • Identify the nature of the contradiction:

    • Determine whether contradictions are direct (opposing claims) or indirect (incomplete context)

    • Categorize contradictions into types, such as those involving expression patterns, activity levels, or substrate specificity

  • Examine methodological differences:

    • Compare experimental conditions, including:

      • Protein expression systems and purification methods

      • Assay conditions (temperature, pH, buffer composition)

      • Substrate sources and concentrations

      • Detection methods and sensitivity

  • Consider biological context:

    • Assess species differences if comparing orthologs (e.g., MSMEG_2934 vs. Rv2611c)

    • Evaluate temporal context (growth phase, induction conditions)

    • Examine environmental phenomena that might influence results

  • Validate with multiple approaches:

    • Use orthogonal experimental methods to test the same hypothesis

    • Employ both in vitro and in vivo approaches when possible

    • Normalize experimental conditions when comparing results across studies

  • Consult with domain experts:

    • Engage with researchers experienced in mycobacterial enzymology

    • Consider collaborative experiments to resolve discrepancies

When reporting contradictory findings, researchers should clearly document all experimental conditions to facilitate future resolution of discrepancies. This approach aligns with systematic methods for analyzing contradictions in biomedical research and helps advance scientific understanding through careful evaluation of conflicting claims .

How can structural analysis of MSMEG_2934 contribute to inhibitor design?

Structural analysis of MSMEG_2934 provides valuable insights for rational inhibitor design, potentially leading to novel compounds that could disrupt mycobacterial cell wall biosynthesis. Key approaches include:

  • Protein structure determination:

    • X-ray crystallography of purified MSMEG_2934, possibly in complex with substrates or product analogs

    • Cryo-electron microscopy for visualization of protein-substrate interactions

    • NMR spectroscopy for dynamic structural information

    • In-Source Decay (ISD) mass spectrometry for primary structure confirmation

  • Active site mapping:

    • Identification of catalytic residues through site-directed mutagenesis

    • Substrate docking simulations to identify binding pockets

    • Analysis of conserved domains across orthologous acyltransferases

  • Structure-based inhibitor design:

    • Virtual screening of compound libraries against the MSMEG_2934 structure

    • Fragment-based drug discovery approaches

    • Design of transition state analogs or substrate mimics

  • Validation of potential inhibitors:

    • In vitro enzyme inhibition assays using the established radioactive assays

    • Structure-activity relationship studies

    • Assessment of inhibitor specificity versus human enzymes

Understanding the structural basis of MSMEG_2934 function is particularly valuable because its ortholog in M. tuberculosis (Rv2611c) is involved in the biosynthesis of cell wall components critical for mycobacterial survival and pathogenesis. Inhibitors developed against MSMEG_2934 might serve as lead compounds for novel anti-tuberculosis therapeutics, especially given the increasing prevalence of drug-resistant tuberculosis strains.

What are the implications of MSMEG_2934 research for understanding mycobacterial pathogenesis?

Research on MSMEG_2934 has broader implications for understanding mycobacterial pathogenesis, particularly in the context of M. tuberculosis infections:

  • Cell wall integrity and permeability:

    • MSMEG_2934 contributes to the synthesis of acylated phosphatidylinositol mannosides, which are important components of the mycobacterial cell envelope

    • These structures influence cell wall permeability, which affects both bacterial survival and antibiotic susceptibility

    • Understanding the molecular details of cell wall assembly may reveal vulnerabilities in the mycobacterial defense system

  • Host-pathogen interactions:

    • Cell surface glycolipids modified by acyltransferases like MSMEG_2934 can interact with host immune receptors

    • These interactions may modulate immune responses and contribute to mycobacterial persistence

    • Studying these processes in the non-pathogenic M. smegmatis provides a safer model system for investigating mechanisms relevant to M. tuberculosis

  • Comparative studies with clinical isolates:

    • Analysis of sequence variations in Rv2611c (the M. tuberculosis ortholog) among clinical isolates may reveal correlations with virulence or drug resistance

    • Functional studies comparing the enzymatic activities of MSMEG_2934 and Rv2611c can highlight adaptation mechanisms in pathogenic mycobacteria

  • Potential therapeutic targets:

    • Enzymes involved in cell wall biosynthesis represent attractive targets for antimycobacterial drug development

    • The essential nature of these pathways for bacterial viability increases their value as intervention points

    • Compounds that inhibit MSMEG_2934 might serve as leads for drugs targeting the orthologous enzyme in M. tuberculosis

By advancing our understanding of fundamental cell wall biosynthetic processes through the study of MSMEG_2934, researchers contribute to the broader knowledge base required for developing new strategies to combat mycobacterial infections, including tuberculosis, which remains a significant global health challenge.

How might high-throughput screening approaches be applied to MSMEG_2934 research?

High-throughput screening (HTS) methodologies offer promising avenues for accelerating MSMEG_2934 research and potential inhibitor discovery:

  • Assay adaptation for HTS:

    • Modification of the radioactive assays described previously to fluorescence-based or colorimetric formats compatible with microplate readers

    • Development of FRET-based assays to monitor substrate-enzyme interactions in real-time

    • Coupling enzyme activity to reporter systems that generate detectable signals

  • Compound library screening:

    • Testing diverse chemical libraries against purified MSMEG_2934 to identify inhibitor candidates

    • Natural product extract screening for novel inhibitory compounds

    • Focused libraries based on known acyltransferase inhibitors or substrate analogs

  • Genetic screening approaches:

    • Transposon mutagenesis to identify genes that interact with msmeg_2934

    • CRISPR-Cas9 screens to investigate synthetic lethality with msmeg_2934 mutations

    • Suppressor mutation screens to identify compensatory pathways

  • Computational screening:

    • Virtual screening of in silico libraries against predicted binding sites

    • Molecular dynamics simulations to identify transient binding pockets

    • Machine learning approaches to predict compounds with activity against MSMEG_2934

These high-throughput methodologies can significantly accelerate the pace of discovery in MSMEG_2934 research, potentially leading to novel inhibitors with therapeutic applications or new insights into the role of this enzyme in mycobacterial physiology.

What emerging technologies could enhance our understanding of MSMEG_2934 function?

Several emerging technologies hold promise for advancing our understanding of MSMEG_2934 function and its role in mycobacterial cell wall biosynthesis:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy for visualizing MSMEG_2934 in complex with membrane components

    • Time-resolved X-ray crystallography to capture reaction intermediates

    • Hydrogen-deuterium exchange mass spectrometry to study protein dynamics and substrate interactions

  • Single-molecule approaches:

    • FRET-based single-molecule studies to monitor conformational changes during catalysis

    • Optical tweezers or atomic force microscopy to investigate enzyme-substrate interactions

    • Super-resolution microscopy to visualize enzyme localization in mycobacterial cells

  • Metabolomics and lipidomics:

    • Advanced mass spectrometry techniques to comprehensively analyze lipid modifications

    • Stable isotope labeling to track metabolic flux through pathways involving MSMEG_2934

    • Imaging mass spectrometry to visualize spatial distribution of enzyme products

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis to position MSMEG_2934 within broader cellular pathways

    • Mathematical modeling of cell wall biosynthesis pathways

  • Genome editing technologies:

    • CRISPR-Cas9 for precise genetic manipulation of msmeg_2934

    • Base editing or prime editing for subtle modifications to study structure-function relationships

    • Conditional expression systems to control enzyme levels with temporal precision

By leveraging these innovative technologies, researchers can gain deeper insights into the molecular mechanisms of MSMEG_2934 function, its regulation, and its integration into broader cellular processes, potentially revealing new approaches for therapeutic intervention in mycobacterial infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.