Recombinant Mycobacterium sp. NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Production and Applications

nuoK is produced via recombinant expression in E. coli, with purification yielding lyophilized powder or glycerol-stabilized liquid formulations. Key production parameters include:

ParameterDetailsSource
Expression HostE. coli
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for storage
StabilityAvoid repeated freeze-thaw cycles; store at -20°C/-80°C
Research UseStructural studies, enzymatic assays, and drug-target interactions

This recombinant protein is utilized in studying NDH-1’s role in mycobacterial respiration and as a target for antimicrobial therapies .

Role in Electron Transport and Proton Pumping

nuoK operates within the NDH-1 complex, which shuttles electrons from NADH to menaquinone while translocating protons across the membrane. This process is essential for maintaining the proton gradient required for ATP synthesis .

Antimicrobial Target Potential

NDH-1 is a validated target for antibiotics, as it lacks a direct counterpart in human mitochondria. Recombinant nuoK could serve as a model for screening inhibitors targeting mycobacterial respiration .

Comparative Analysis: Mycobacterium sp. vs. M. bovis nuoK

SpeciesUniProt IDSequence IdentityExpression HostSource
Mycobacterium sp.A3PWR1Full-length (1–99 aa)E. coli
Mycobacterium bovisA1KNF1Full-length (1–99 aa)E. coli

Both proteins share similar structural features but differ in sequence-specific residues (e.g., MNPDNYLYLSALLFTIGAAGVLLRRNVIVVFMCVELMLNAANLAFVAFSRMHGQLDGQVV AFFTMVVAACEVVIGLAIIMTIYRARRSASVDDANLLKH for Mycobacterium sp. vs. MNPANYLYLSVLLFTIGASGVLLRRNAIVMFMCVELMLNAVNLAFVTFARMHGHLDAQMI AFFTMVVAACEVVVGLAIIMTIFRTRKSASVDDANLLKG for M. bovis) .

Challenges and Considerations

  • Stability: Repeated freeze-thaw cycles degrade activity; aliquoting is recommended .

  • Research Gaps: Limited data on nuoK’s precise role in NDH-1 assembly or inhibitor binding.

  • Therapeutic Potential: NDH-1’s complexity complicates drug design, though recombinant nuoK aids in structural studies .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, kindly specify them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
nuoK; Mkms_1594; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Mycobacterium sp. (strain KMS)
Target Names
nuoK
Target Protein Sequence
MNPDNYLHLSALLFTIGAAGVLLRRNVIVVFMCVELMLNAANLAFVAFSRMHGQLDGQVV AFFTMVVAACEVVIGLAIIMTIYRARRSASVDDANLLKH
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be a menaquinone. The enzyme couples the redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural relationship between nuoK and other subunits in the Mycobacterium NDH-1 complex?

The nuoK subunit is one of 14 genes in the nuo-operon that codes for the type I NADH dehydrogenase (NDH-1) complex in Mycobacterium species. It functions as part of the membrane domain of this complex, alongside other subunits including nuoG. The NDH-1 complex is a multi-subunit enzyme that catalyzes the transfer of electrons from NADH to quinone coupled with proton translocation across the membrane .

Structurally, nuoK is a hydrophobic subunit that contributes to the proton-pumping mechanism of NDH-1. Analysis of the complete NDH-1 complex reveals that nuoK is positioned within the membrane domain, where it interacts with nuoL, nuoM, and nuoN to form a proton translocation pathway. This arrangement is essential for the complex's function in energy generation and potentially in virulence mechanisms.

How does nuoK conservation compare across pathogenic and non-pathogenic Mycobacterium species?

The conservation of nuoK across Mycobacterium species follows a pattern similar to that observed with other subunits like nuoG. In virulent mycobacteria, there is a high degree of sequence homology (approximately 98-99% identity), suggesting functional importance . Based on comparative analysis:

Mycobacterium SpeciesnuoK Homology to M. tuberculosisNotable Features
M. tuberculosis100% (reference)Complete nuo-operon present
M. bovis BCG~99%Conservation suggests retained functionality
M. kansasii~70-80%Modified functional properties
M. smegmatis~70%Significant sequence divergence
M. lepraePseudogene or absentnuo-operon largely deleted except pseudogenes

The high conservation of nuoK in pathogenic species suggests its importance in virulence mechanisms, similar to what has been demonstrated for nuoG in M. tuberculosis .

What methodologies are suitable for initial characterization of nuoK function?

For initial characterization of nuoK function, researchers should implement a multi-faceted approach:

  • Gene expression analysis: RT-PCR and quantitative PCR to measure nuoK transcription levels under various conditions, including during infection .

  • Protein localization studies: Fusion protein approaches, though with caution as membrane proteins like nuoK may be difficult to express with tags without disrupting function.

  • Comparative genomics: Analysis of nuoK sequences across mycobacterial species to identify conserved domains and predict functional motifs.

  • In silico modeling: Using structural prediction tools to model nuoK's position within the NDH-1 complex based on homology to better-characterized bacterial NADH dehydrogenases.

  • Growth analysis: Comparing growth rates of wild-type and nuoK-modified strains under different conditions to assess impact on basic bacterial physiology .

When designing these initial experiments, researchers should be aware that like other NDH-1 components, nuoK may be involved in both energy production and specialized functions related to pathogenesis.

What are the most effective genetic manipulation strategies for studying nuoK function?

For studying nuoK function in mycobacteria, several genetic manipulation strategies have proven effective, with methodology choices depending on research objectives:

Gene Deletion Approaches:

  • Homologous recombination-based knockout: This approach, similar to that used for nuoG studies, involves replacing the nuoK gene with an antibiotic resistance marker . The method requires:

    • Construction of a knockout vector containing ~1kb homologous flanking regions

    • Confirmation of deletion using PCR and Southern blotting

    • Growth analysis to confirm viability of the mutant

  • CRISPR-Cas9 system: For precise genomic editing without antibiotic markers, particularly useful for multiple gene manipulations.

Complementation Strategies:

  • Chromosomal integration: Using integrative plasmids (e.g., at the attB site) to express nuoK behind a constitutive promoter, ensuring stable expression .

  • Episomal expression: Useful for testing multiple variants or for overexpression studies.

Conditional Expression Systems:

  • Tetracycline-inducible systems: Allow for controlled expression to study the effects of nuoK depletion.

  • Degradation tag systems: For post-translational control of nuoK protein levels.

How can researchers effectively express and purify recombinant nuoK for structural and functional studies?

Expression and purification of membrane proteins like nuoK presents significant challenges. Based on established protocols for similar mycobacterial membrane proteins:

Expression Systems:

  • E. coli-based systems:

    • BL21(DE3) with specialized vectors containing fusion partners (MBP, SUMO) to enhance solubility

    • C41/C43 strains specialized for membrane protein expression

    • Codon-optimized constructs to account for mycobacterial codon bias

  • Mycobacterial expression systems:

    • M. smegmatis expression for native-like membrane insertion

    • Controlled expression using acetamide-inducible promoters

Purification Strategy:

  • Membrane fraction isolation using differential centrifugation

  • Solubilization with appropriate detergents (DDM, LDAO, or DMNG)

  • Affinity chromatography using engineered tags (His, Strep)

  • Size exclusion chromatography for final purity

Functional Verification:

  • Reconstitution into proteoliposomes for activity assays

  • NADH oxidation assays in the presence of artificial electron acceptors

  • Proton pumping assays using pH-sensitive fluorescent dyes

For structural studies, researchers should consider:

  • Cryo-EM for the intact NDH-1 complex

  • NMR studies for specific protein-protein interactions

  • Crystallography attempts after removal of highly flexible regions

When expressing recombinant nuoK, researchers should carefully monitor for potential toxicity issues, as overexpression of membrane proteins can disrupt cellular homeostasis and yield misleading results.

What experimental design approaches best assess the role of nuoK in bacterial virulence?

Based on successful approaches used to study nuoG's role in virulence , the following experimental design approaches are recommended for investigating nuoK's contribution to bacterial pathogenicity:

In Vitro Infection Models:

  • Macrophage infection assays: Compare wild-type, nuoK-deleted, and complemented strains for:

    • Intracellular survival rates

    • Host cell apoptosis induction (TUNEL assays)

    • Cytokine response profiles

    • ROS/RNS production and bacterial resistance

  • Comparative virulence testing: Express mycobacterial nuoK in non-pathogenic species (e.g., M. smegmatis) to assess gain-of-function effects on virulence markers .

In Vivo Infection Models:

  • Mouse infection models:

    • Both immunocompromised (SCID) and immunocompetent (BALB/c) mice

    • Analysis parameters should include:

      • Survival curves

      • Bacterial burden in lungs, spleen, and liver

      • Histopathological assessment

      • In situ apoptosis detection

  • Time-course studies: Assessment at early (3 weeks), intermediate (10 weeks), and late (20 weeks) stages of infection to capture dynamic changes in pathology and immune response .

Data Collection and Analysis:

  • Use of CFU counting, immunohistochemistry, flow cytometry, and transcriptomics

  • Statistical analysis using Kaplan-Meier survival curves with log-rank tests

  • CFU data should be analyzed using ANOVA with appropriate post-hoc tests

When designing these experiments, researchers should ensure proper controls including wild-type, gene-deleted, and complemented strains to definitively attribute observed phenotypes to nuoK function .

How should researchers address potential polar effects when creating nuoK mutants?

When manipulating nuoK within the nuo-operon, researchers must carefully design experiments to distinguish between direct effects of nuoK deletion and polar effects on downstream genes. Based on established approaches from nuoG research :

Strategies to Minimize and Assess Polar Effects:

  • In-frame deletion construction: Design deletions that maintain the reading frame to prevent disruption of downstream gene expression.

  • Complementation analysis:

    • Single-gene complementation with nuoK under a constitutive promoter

    • Operon segment complementation if single-gene approach shows partial rescue

    • Quantification of complementation efficiency through phenotypic assays

  • Transcript analysis:

    • RT-PCR of genes downstream of nuoK to assess expression levels

    • qPCR to quantify potential reduction in downstream gene transcription

  • Proteomics verification:

    • 2D gel electrophoresis to confirm no major changes in the bacterial proteome

    • Targeted Western blot analysis of other nuo-operon components

  • Functional testing:

    • Biochemical assessment of NDH-1 complex activity

    • Phenotypic comparison with mutants of other nuo genes

Interpreting Residual Phenotypes:
In the nuoG studies, complemented mutants showed complete reversal of in vitro phenotypes but residual effects in vivo, suggesting minor polar effects . Researchers should be prepared to:

  • Document any residual phenotypes after complementation

  • Quantify the magnitude of these effects

  • Discuss potential implications for interpreting nuoK's specific role versus broader NDH-1 complex functions

This systematic approach allows researchers to confidently attribute observed phenotypes to nuoK rather than to disruption of the entire nuo-operon.

What statistical approaches are most appropriate for analyzing nuoK-related phenotypic data?

When analyzing phenotypic data related to nuoK function, researchers should employ statistical methods appropriate for the experimental design and data characteristics:

For Survival Studies:

  • Kaplan-Meier survival analysis with log-rank tests to compare survival curves between wild-type, mutant, and complemented strains .

  • Hazard ratio calculations to quantify differences in mortality risk.

For Bacterial Growth and Burden Data:

  • Repeated measures ANOVA for time-course experiments monitoring in vitro growth or in vivo bacterial loads.

  • Post-hoc tests (Tukey's or Bonferroni) for pairwise comparisons between experimental groups .

  • Log transformation of CFU data before analysis to normalize distributions.

For Host Cell Response Data:

  • Student's t-test or Mann-Whitney U test (depending on normality) for comparing apoptosis rates between two groups.

  • One-way ANOVA followed by appropriate post-hoc tests for comparing multiple groups .

  • Two-way ANOVA when assessing interactions between bacterial strain and experimental conditions.

For Correlation Analyses:

  • Pearson's or Spearman's correlation to assess relationships between nuoK expression levels and phenotypic outcomes.

  • Multiple regression analysis to identify predictors of virulence when multiple variables are involved.

For Omics Data:

  • Principal Component Analysis (PCA) for visualizing clustering in high-dimensional data.

  • Pathway enrichment analysis for identifying biological processes affected by nuoK manipulation.

Sample Size Considerations:

  • Power analysis should be conducted a priori to determine appropriate sample sizes

  • For animal studies, researchers should follow the principle of minimizing animal use while maintaining statistical power

  • For in vitro experiments, a minimum of three biological replicates with technical duplicates is recommended

All statistical analyses should be accompanied by appropriate visualizations (survival curves, bar graphs with error bars, scatter plots) to facilitate interpretation of results .

How can researchers resolve contradictory findings regarding nuoK function across different mycobacterial species?

When faced with contradictory findings regarding nuoK function across different mycobacterial species, researchers should implement a systematic approach to reconcile these discrepancies:

1. Sequence-Function Relationship Analysis:

  • Conduct detailed sequence alignments of nuoK across species

  • Identify key amino acid differences that might explain functional variation

  • Perform domain swapping experiments to test functional hypotheses

2. Standardization of Experimental Methods:

  • Ensure consistent growth conditions and media composition

  • Normalize protein expression levels when comparing across species

  • Use identical assay conditions for functional measurements

3. Consideration of Genomic Context:

  • Examine differences in nuo-operon organization between species

  • Assess potential compensatory mechanisms (e.g., alternative NADH dehydrogenases)

  • Analyze co-evolution of interacting proteins

4. Combined Methodological Approaches:

  • Use both gain-of-function and loss-of-function approaches

  • Implement complementation experiments across species barriers

  • Apply both in vitro biochemical and in vivo infection models

5. Meta-analysis Framework:
Researchers should organize contradictory findings using a framework like:

SpeciesnuoK FunctionExperimental ApproachPotential Confounding FactorsReconciliation Strategy
M. tuberculosisFunction AApproach XFactor 1Strategy α
M. smegmatisFunction BApproach YFactor 2Strategy β

This table structure helps identify whether differences arise from true biological variation versus methodological differences.

6. Evolutionary Context Consideration:
Differential function may reflect evolutionary adaptation to different niches. For example, pathogenic mycobacteria like M. tuberculosis may have evolved specialized functions for nuoK related to virulence, similar to what has been observed with nuoG , while non-pathogenic species maintain only the basic metabolic functions.

By systematically applying these approaches, researchers can determine whether contradictory findings represent true biological differences in nuoK function or result from experimental variation.

What are the most promising approaches for targeting nuoK in antimycobacterial drug development?

Based on findings regarding the importance of NDH-1 complex components in mycobacterial virulence , the following approaches show promise for targeting nuoK in antimycobacterial drug development:

Structure-Based Drug Design Approaches:

  • Inhibitor screening: Development of high-throughput screening assays using recombinant nuoK protein or reconstituted NDH-1 subcomplexes.

  • Fragment-based drug discovery: Identification of small molecule fragments that bind to critical regions of nuoK.

  • In silico docking studies: Virtual screening of compound libraries against nuoK structural models, prioritizing compounds that interfere with:

    • Protein-protein interactions within the NDH-1 complex

    • Proton translocation pathways

    • Conformational changes required for function

Functional Inhibition Strategies:

  • Proton translocation inhibitors: Compounds that specifically block the proton pumping function associated with nuoK without affecting other cellular functions.

  • Allosteric modulators: Molecules that bind to regulatory sites on nuoK, altering its conformation and disrupting NDH-1 complex assembly or stability.

  • Peptide-based inhibitors: Designed peptides that mimic interacting regions of nuoK partners to compete for binding sites.

Combination Therapy Approaches:

  • Synergistic targeting: Combining nuoK inhibitors with compounds targeting other NADH dehydrogenases (ndh and ndhA) .

  • Host-directed therapy combinations: Pairing nuoK inhibitors with compounds that enhance host cell apoptosis to counteract the anti-apoptotic effects of the NDH-1 complex .

Validation and Testing Methodologies:

  • Genetic validation: Using nuoK mutant strains as controls to confirm mechanism of action for potential inhibitors .

  • Ex vivo infection models: Testing candidates in primary human macrophages infected with mycobacteria.

  • In vivo efficacy studies: Using established mouse models of infection to assess therapeutic potential .

When pursuing these approaches, researchers should consider that targeting nuoK may be particularly effective against persistent infections, given the link between NDH-1 function and virulence mechanisms that contribute to bacterial persistence .

How can systems biology approaches enhance our understanding of nuoK's role in mycobacterial metabolism and virulence?

Systems biology approaches offer powerful methodologies to comprehensively understand nuoK's role within the complex network of mycobacterial metabolism and virulence mechanisms:

Multi-omics Integration Strategies:

  • Transcriptomics: RNA-seq analysis comparing wild-type and nuoK mutant strains under various conditions to identify gene expression networks affected by nuoK deletion.

  • Proteomics: Quantitative proteomics to detect changes in protein abundance and post-translational modifications resulting from nuoK manipulation .

  • Metabolomics: Analysis of metabolic profiles to understand how nuoK affects central carbon metabolism and energy production.

  • Lipidomics: Assessment of changes in mycobacterial cell wall lipid composition, which may affect host interactions.

Network Analysis Approaches:

  • Protein-protein interaction networks: Identification of nuoK interaction partners beyond the NDH-1 complex.

  • Metabolic flux analysis: Using isotope labeling to quantify changes in metabolic pathway utilization.

  • Gene regulatory network reconstruction: Identifying transcription factors and regulatory elements affected by nuoK function.

Computational Modeling:

  • Genome-scale metabolic models: Integration of nuoK function into existing mycobacterial metabolic models to predict systemic effects of nuoK manipulation.

  • Agent-based models: Simulation of host-pathogen interactions incorporating nuoK-dependent virulence mechanisms.

  • Machine learning approaches: Pattern recognition in multi-omics data to identify non-obvious connections between nuoK and virulence phenotypes.

Host-Pathogen Interface Analysis:

  • Dual RNA-seq: Simultaneous profiling of host and bacterial transcriptomes during infection with wild-type versus nuoK mutant strains.

  • Spatial transcriptomics: Mapping gene expression changes in different microenvironments within infected tissues.

  • Single-cell analysis: Characterizing heterogeneity in bacterial populations and host responses.

Implementation of these systems approaches requires:

  • Careful experimental design with appropriate controls

  • Robust statistical methods for analyzing high-dimensional data

  • Computational infrastructure for data integration

  • Validation of key predictions through targeted experiments

This integrated approach can reveal how nuoK functions not only in energy metabolism but potentially in signaling networks and host interaction mechanisms, similar to the dual role discovered for nuoG in both metabolism and apoptosis inhibition .

What methodological approaches are most effective for studying nuoK's potential interaction with host immune responses?

To effectively study nuoK's potential interactions with host immune responses, researchers should employ methodologies that bridge bacterial genetics, immunology, and cell biology:

In Vitro Immunological Assays:

  • Macrophage infection models comparing wild-type, nuoK-deleted, and complemented strains to assess:

    • Pattern recognition receptor activation

    • Inflammasome assembly and activation

    • Cytokine and chemokine production profiles measured by multiplex ELISA

    • Antigen presentation capacity to T cells

  • ROS/RNS production assays:

    • Fluorescent probe-based detection of reactive oxygen/nitrogen species

    • Assessment of phagosomal pH regulation

    • Quantification of bacterial sensitivity to oxidative stress

  • Cell death pathway analysis:

    • Flow cytometry with annexin V/PI staining to distinguish apoptosis versus necrosis

    • Caspase activation assays

    • TUNEL staining for DNA fragmentation

    • Western blot analysis of apoptotic pathway proteins

Ex Vivo Analysis Systems:

  • Primary cell cultures:

    • Human or mouse primary macrophages

    • Dendritic cells

    • Neutrophils

    • Mixed cell populations from lung tissue

  • Precision-cut lung slices to maintain tissue architecture and cellular interactions

In Vivo Immunological Assessment:

  • Immune cell profiling in infected tissues:

    • Flow cytometry of lung homogenates

    • Immunohistochemistry

    • Single-cell RNA sequencing

  • Cytokine dynamics tracking:

    • In vivo cytokine reporter systems

    • Serial sampling of bronchoalveolar lavage fluid

  • Granuloma analysis:

    • Detailed histopathological assessment

    • Immunofluorescence microscopy for immune cell markers

Genetic Approaches in Host and Pathogen:

  • Bacterial side: nuoK mutations combined with other virulence factor mutations to assess additive or synergistic effects

  • Host side:

    • Use of knockout mice lacking specific immune components

    • CRISPR-engineered macrophage cell lines

Data Integration Methods:

  • Correlation analysis between bacterial burden, immune parameters, and disease pathology

  • Multiparameter statistical modeling to identify key immune pathways affected by nuoK

When implementing these approaches, researchers should:

  • Include appropriate controls (wild-type, mutant, and complemented strains)

  • Perform time-course analyses to capture dynamic interactions

  • Consider both early innate and later adaptive immune responses

  • Validate key findings across multiple experimental systems

This comprehensive approach will help determine whether nuoK, like nuoG, plays a role in modulating host immune responses, particularly apoptosis inhibition which has been shown to be a key virulence mechanism for the NDH-1 complex .

What are the key experimental controls required for definitive studies on nuoK function?

When conducting definitive studies on nuoK function in Mycobacterium species, the following experimental controls are essential to ensure reliable and interpretable results:

Genetic Controls:

  • Wild-type strain: The parental mycobacterial strain with intact nuoK gene.

  • Clean deletion mutant: A nuoK deletion strain constructed with minimal disruption to surrounding genes .

  • Complemented strain: The deletion mutant with nuoK reintroduced at a neutral site under an appropriate promoter .

  • Point mutant controls: Strains with specific amino acid changes to distinguish functional domains of nuoK.

  • Related gene controls: Mutants of other NDH-1 subunits (e.g., nuoG) to compare phenotypes .

Expression Controls:

  • Transcript verification: RT-PCR or RNA-seq to confirm absence of nuoK transcript in mutants and appropriate expression in complemented strains .

  • Protein detection: Western blot or proteomics to confirm protein expression levels in complemented strains relative to wild-type.

  • Promoter activity control: Assessment of the chosen promoter's activity under experimental conditions.

Phenotypic Controls:

  • Known phenotype controls: Include strains with established phenotypes (e.g., attenuated or hypervirulent) as benchmarks.

  • Dose-response controls: Use multiple infection doses or protein concentrations to establish relationship with phenotypic outcomes.

  • Temporal controls: Perform analyses at multiple time points to capture dynamic effects .

Technical Controls:

  • Vehicle controls: For drug studies or chemical treatments.

  • Assay-specific controls: Positive and negative controls for each specific assay used.

  • Species-specific controls: When comparing across mycobacterial species, include appropriate controls for each species .

Statistical Considerations:

  • Biological replicates: Minimum of three independent experiments.

  • Technical replicates: Multiple measurements within each biological replicate.

  • Randomization: Random assignment of animals to experimental groups in in vivo studies.

  • Blinding: Analysis of histopathology and other subjective measures by blinded observers .

Implementation of these comprehensive controls will allow researchers to confidently attribute observed phenotypes specifically to nuoK function rather than to experimental artifacts or secondary effects.

How should researchers integrate findings on nuoK with the broader understanding of NDH-1 complex function in mycobacteria?

To effectively integrate findings on nuoK with broader understanding of the NDH-1 complex, researchers should implement a multi-level interpretive framework:

Structural-Functional Integration:

Metabolic Context Integration:

Virulence Mechanism Integration:

  • Comparative virulence analysis: Systematically compare phenotypes of nuoK mutants with mutants of other NDH-1 subunits (particularly nuoG) in standardized virulence assays .

  • Mechanism dissection: Determine whether nuoK contributes to virulence through the same mechanisms as other subunits (e.g., apoptosis inhibition) or through distinct pathways .

  • Host response integration: Create an integrated model of how different NDH-1 subunits collectively modulate host immune responses.

Data Integration Framework:

  • Centralized database development: Establish repositories for standardized phenotypic data from NDH-1 subunit studies.

  • Meta-analysis approaches: Perform systematic reviews of all available data on NDH-1 subunits.

  • Network visualization tools: Create interactive models showing relationships between subunits, phenotypes, and host responses.

Practical Implementation Strategies:

  • Collaborative research networks: Establish consortia focused on comprehensive NDH-1 characterization.

  • Standardized protocols: Develop common experimental approaches for comparing subunit functions.

  • Integrated publications: Move beyond single-subunit studies to comprehensive analyses of NDH-1 function.

By implementing this integrative approach, researchers can move from a reductionist understanding of individual subunits like nuoK to a systems-level comprehension of how the entire NDH-1 complex contributes to mycobacterial physiology and pathogenesis, potentially revealing emergent properties not apparent from studying individual components in isolation .

What are the most significant challenges researchers should anticipate when working with recombinant nuoK, and how can these be addressed?

Researchers working with recombinant nuoK should anticipate several significant challenges inherent to membrane protein research, particularly with mycobacterial proteins. Based on experiences with similar proteins, the following challenges and solutions are important to consider:

Expression Challenges:

  • Protein toxicity: Overexpression of membrane proteins like nuoK can be toxic to host cells.

    • Solution: Use tightly regulated inducible expression systems with low basal expression

    • Solution: Employ specialized host strains designed for toxic membrane protein expression

  • Inclusion body formation: Recombinant membrane proteins often aggregate in inclusion bodies.

    • Solution: Expression at lower temperatures (16-20°C)

    • Solution: Fusion with solubility-enhancing tags (MBP, SUMO, Trx)

    • Solution: Co-expression with molecular chaperones

  • Codon usage differences: Mycobacterial codon bias differs from common expression hosts.

    • Solution: Codon optimization for expression host

    • Solution: Use of hosts with rare tRNA supplementation

Purification Challenges:

  • Detergent selection: Finding detergents that maintain nuoK in native conformation.

    • Solution: Systematic screening of detergent panels

    • Solution: Use of milder alternatives like nanodisc or amphipol technology

  • Protein stability: Maintaining stability during purification procedures.

    • Solution: Addition of lipids during purification

    • Solution: Use of stabilizing ligands or binding partners

  • Complex dissociation: Isolation of nuoK may disrupt essential interactions with other NDH-1 subunits.

    • Solution: Co-expression and co-purification with interacting partners

    • Solution: Mild solubilization conditions to maintain native complexes

Functional Analysis Challenges:

  • Activity reconstitution: Ensuring purified nuoK retains native function.

    • Solution: Reconstitution into proteoliposomes with defined lipid composition

    • Solution: Development of robust functional assays specific to nuoK

  • Structural analysis difficulties: Membrane proteins are challenging for structural biology.

    • Solution: Cryo-EM approaches for the intact NDH-1 complex

    • Solution: Hybrid approaches combining computational modeling with experimental constraints

  • Ensuring physiological relevance: In vitro findings may not translate to in vivo function.

    • Solution: Correlation of in vitro findings with phenotypes of genetic mutants

    • Solution: Validation in cell-based systems

Technical Implementation Strategies:

  • Stepwise approach: Start with expression optimization before addressing purification challenges

  • Construct library generation: Create multiple versions of nuoK with different tags, fusion partners, and truncations

  • Cross-validation: Use multiple expression and purification approaches in parallel

  • Species comparison: Work with nuoK homologs from different mycobacterial species simultaneously to identify the most amenable for biochemical studies

By anticipating these challenges and implementing the suggested solutions, researchers can significantly improve their chances of successfully working with recombinant nuoK, ultimately enabling deeper structural and functional insights into this important component of mycobacterial physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.