Recombinant Mycobacterium sp. Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Functional Roles

HtpX homologs in mycobacteria contribute to:

  • Membrane Protein Homeostasis: Degrades misfolded membrane proteins (e.g., SecY in E. coli) via endoprotease activity .

  • Stress Adaptation: Maintains cell viability under environmental stressors like heat or antibiotic exposure .

  • Zinc Dependency: Requires Zn²⁺ for self-cleavage and substrate degradation, with optimal activity at pH 7.4–8.0 and 37–50°C .

Key Research Findings:

  • Purified recombinant HtpX degrades casein and solubilized membrane proteins in vitro .

  • In Mycobacterium smegmatis, HtpX interacts with essential proteins like LppZ to counteract toxic cell wall enzymes .

  • Loss of HtpX causes hypersensitivity to detergents and cell wall-targeting antibiotics .

Expression and Purification

Production challenges include self-degradation upon membrane solubilization. Standard protocols involve:

  1. Denaturing Purification: Extraction from inclusion bodies using urea or guanidine hydrochloride .

  2. Refolding: Zinc chelators (e.g., EDTA) stabilize the enzyme during renaturation .

  3. Chromatography: Cation exchange and gel filtration yield >90% purity .

Table 2: Enzymatic Properties

PropertyValueSource
Optimal pH7.4
Optimal Temperature37–50°C
InhibitorsEDTA, 1,10-phenanthroline
SubstratesCasein, SecY, misfolded proteins

Comparative Analysis with Mycobacterial Proteases

HtpX differs from other proteases in the mycobacterial proteostasis network:

Table 3: HtpX vs. HtrA and MarP

FeatureHtpXHtrA (PepD)MarP
Catalytic TypeZinc metalloproteaseSerine proteaseSerine protease
LocalizationMembrane-boundPeriplasmicPeriplasmic
EssentialityNon-essentialNon-essentialEssential
SubstratesMembrane proteins35-kDa antigenPeptides, β-casein
RoleStress responseVirulence modulationpH homeostasis
Sources

Applications and Research Implications

  • Drug Target Potential: HtpX’s role in stress response makes it a candidate for anti-mycobacterial therapies .

  • Biochemical Tools: Used to study membrane protein degradation pathways in synthetic biology .

  • Structural Studies: Crystallization efforts aim to resolve mechanisms of zinc-dependent proteolysis .

Limitations and Future Directions

  • Instability: Requires zinc chelators during purification to prevent autolysis .

  • Substrate Specificity: Poorly characterized compared to homologs like E. coli HtpX .

  • In Vivo Studies: Limited data on HtpX’s role in Mycobacterium tuberculosis pathogenesis .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery time estimates, please consult your local distributor.
All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is preferred, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in sterile deionized water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; Mkms_0786; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Mycobacterium sp. (strain KMS)
Target Names
htpX
Target Protein Sequence
MTWNPHANRFKTFLLLVGMSALIVFVGSLFGRSIMALAVLFAVGMNVYVYFNSDKLALKA MHAQPVSELQAPVMYRIVRELSNAAHQPMPRLYISDTANPNAFATGRNPRNSAVCCTTGI LQILNERELRAVLGHELSHVYNRDILISCVAGAMASVITALANIALFAGMFGGNREGTNP FALLLVSFLGPIAATVVRLAVSRSREYQADQSGAELTGDPLALASALRKISGGVEAAPLP PQPQLADQAHLMIASPFRSGEKIGKLFSTHPPMADRIRRLEEMAGRGPGLY
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Mycobacterium protease HtpX homolog?

Protease HtpX homolog is a membrane-bound zinc metalloprotease found in various Mycobacterium species. The protein primarily consists of two transmembrane segments, a small N-terminal domain, and a larger C-terminal domain . The number of amino acids in HtpX proteins typically ranges from 279 to 336, with specific variants such as M. leprae strain Br4923 containing 287 amino acids and M. ulcerans containing 286 amino acids . Structurally, these proteins exhibit hydrophobic properties that enable them to reside in and interact with biological membranes . The protein's hydrophobicity is essential for its integration into the cell membrane, where it performs its proteolytic functions.

What are the fundamental biochemical properties of HtpX proteins?

HtpX proteins from Mycobacterium species demonstrate several key biochemical characteristics:

  • pH profile: They range from slightly acidic to basic in nature

  • Thermal stability: They exhibit high thermal stability

  • Hydrophobicity: Predominantly hydrophobic to facilitate membrane integration

  • Enzymatic activity: Function as zinc metalloproteases with autocatalytic properties in the presence of Zn²⁺

  • Conserved regions: Contain multiple conserved residues (19 conserved & exposed, 38 conserved & buried)

These properties collectively enable HtpX to function effectively in the proteolytic quality control of membrane proteins. The autocatalytic cleavage ability in the presence of zinc ions represents a distinctive feature that contributes to its activation mechanism .

How does HtpX function in Mycobacterial biology?

HtpX functions as a heat-inducible protein that participates in the proteolytic quality control of membrane proteins . It belongs to the heat shock protein family, suggesting its role in stress response mechanisms in Mycobacterium species. The protein's membrane-bound nature enables it to access and cleave misfolded or damaged membrane proteins, thereby maintaining membrane protein homeostasis. Any structural or functional disturbance in HtpX may potentially lead to infections, as suggested by its association with endodontic infections . The protein's quality control function is particularly critical in Mycobacterium species like M. tuberculosis, which are known for their ability to invade multiple organs and develop drug resistance through mutation mechanisms .

Advanced Research Questions

Computational proteomic analysis has proven invaluable for understanding HtpX structure-function relationships. A comprehensive computational approach should include:

  • Sequence retrieval and homology analysis: Obtaining protein sequences from UniProt and performing homology searches via UniProt BLAST to identify conserved regions

  • Physicochemical characterization: Utilizing tools like ProtParam to determine properties such as molecular weight, theoretical pI, instability index, and grand average of hydropathicity (GRAVY)

  • Multiple sequence alignment: Employing CLUSTALW to identify conserved residues across species

  • Molecular phylogenetics: Analyzing evolutionary relationships using MEGA11, which has revealed Polynucleobacter necessarius as an ancestral organism for selected HtpX homologs

  • Protein disorder prediction: Using PONDR to identify disordered regions (ranging from 18.53% to 43.69%), which provide functional flexibility for assembling linkers and macromolecular complexes to attach with host cell receptors

  • Protein-protein interaction analysis: Employing STRING to identify functional partners, which for HtpX include def, Pnec_1775, fmt, Pnec_1774, Pnec_1773, Pec_1772, ftsH, Pnec_1779, Pnec_1611, and grpE

  • Per-site evolutionary rate estimation: Using ConSurf to identify conserved residues that may be critical for function

These computational methods provide critical insights into HtpX function without requiring extensive laboratory resources, offering efficient preliminary analysis before experimental validation.

How does HtpX contribute to pathogenicity in Mycobacterium species?

While direct virulence prediction studies have categorized HtpX homologs as non-virulent , their association with pathogenicity appears to be indirect through their role in membrane protein quality control. Several mechanisms may explain this contribution:

  • Membrane integrity maintenance: By ensuring proper membrane protein folding and degradation of misfolded proteins, HtpX helps maintain cellular membrane integrity critical for bacterial survival in host environments

  • Stress response: As a heat shock protein, HtpX likely plays a role in the bacterial stress response, potentially contributing to survival under host-induced stress conditions

  • Evolutionary conservation: Phylogenetic analysis suggests that related organisms cluster together, indicating they might share common pathogenic strategies despite HtpX itself not being directly virulent

  • Infection association: The association of HtpX with endodontic infections suggests that structural or functional disturbances in this protein may influence pathogenic potential

  • Disordered regions: The presence of significant disordered regions (18.53-43.69%) provides functional flexibility that may enable attachment to host cell receptors through the assembly of linkers and macromolecular complexes

Understanding these mechanisms is essential for developing targeted therapeutic strategies against Mycobacterium infections.

What are the current approaches for targeting HtpX in vaccine development?

HtpX homologs are being investigated as potential components in vaccine development strategies against Mycobacterium infections . The current approaches include:

  • Recombinant protein production: Development of recombinant Mycobacterium strains expressing HtpX, such as M. leprae HtpX (aa 1-287) and M. ulcerans HtpX (aa 1-286)

  • Structural analysis: Identification of conserved epitopes through computational and structural analysis to target immune responses effectively

  • Expression system optimization: Selection of appropriate expression systems (E. coli, yeast, baculovirus, or mammalian cells) to produce properly folded recombinant HtpX with native antigenic properties

  • Conserved residue targeting: Focusing on the 19 conserved & exposed residues identified through computational analysis as potential vaccine targets

  • Protein-protein interaction consideration: Accounting for HtpX's functional partners in formulating multi-component vaccine strategies

It's important to note that while these approaches show promise in research settings, current recombinant HtpX products are strictly for research purposes and cannot be used directly on humans or animals .

What purification and characterization techniques are most effective for recombinant HtpX?

Effective purification and characterization of recombinant HtpX requires specialized techniques to maintain protein structure and function. Based on research practices with membrane proteins, the following methods are recommended:

StageTechniqueSpecific ConditionsPurpose
Initial ExtractionDetergent SolubilizationDDM (n-Dodecyl β-D-maltoside)Solubilize membrane proteins
PurificationAffinity ChromatographyImmobilized metal affinity (IMAC)Capture His-tagged proteins
Further PurificationSize Exclusion ChromatographyVarious detergents (DDM, DM, C12E7)Remove aggregates and contaminants
CrystallizationVapor DiffusionHanging drop method with specific detergentsStructure determination
Functional CharacterizationZinc-Dependent Activity AssayPresence of Zn²⁺Verify autocatalytic activity
Structural AnalysisCD SpectroscopyFar-UV spectrumSecondary structure analysis
Thermal StabilityDifferential Scanning FluorimetryTemperature gradientAssess protein stability

For HtpX specifically, it's critical to maintain the presence of zinc ions during purification to preserve the metalloprotease activity, while carefully selecting detergents that maintain protein stability without disrupting function .

How can researchers optimize recombinant expression of HtpX to improve yield and activity?

Optimizing recombinant expression of HtpX requires addressing several key factors:

  • Expression system selection: While insect cells are generally preferred for membrane proteins like HtpX , E. coli systems may be suitable for initial screening due to their rapid growth and cost-effectiveness. Consider:

    • Temperature control (often lower temperatures improve folding)

    • Induction timing and concentration

    • Growth media optimization

  • Construct design:

    • Include appropriate tags for purification (His, FLAG)

    • Consider fusion partners that enhance solubility

    • Optimize codon usage for the expression host

    • Include TEV or other protease cleavage sites for tag removal

  • Detergent screening:

    • Systematic testing of detergents for extraction efficiency

    • Common effective detergents include DDM, DM, and C12E8/CYMAL5 combinations

  • Stabilization strategies:

    • Addition of zinc ions during extraction and purification

    • Inclusion of glycerol or other stabilizing agents

    • Temperature control during all purification steps

  • Scale-up considerations:

    • Bioreactor parameters optimization

    • Harvest timing to maximize yield

    • Rapid processing to minimize degradation

By systematically addressing these factors, researchers can significantly improve both the yield and activity of recombinant HtpX preparations.

What analytical methods best resolve contradictions in HtpX structural data?

When faced with contradictory structural data for HtpX, researchers should employ a multi-faceted analytical approach:

  • Integration of computational and experimental methods:

    • Compare experimental structures with predicted models

    • Use ConSurf analysis to identify evolutionarily conserved residues that should maintain consistent structural features

    • Employ molecular dynamics simulations to evaluate structural stability

  • Multiple structural determination techniques:

    • X-ray crystallography for high-resolution static structures

    • Cryo-EM for visualizing different conformational states

    • NMR for dynamic structure analysis in solution

    • Cross-validation between techniques to confirm findings

  • Functional correlation analysis:

    • Site-directed mutagenesis of key residues identified through computational analysis

    • Activity assays following mutations to correlate structure with function

    • Binding studies to confirm interaction sites

  • Membrane environment considerations:

    • Analyze structures in different detergent or lipid environments

    • Account for membrane composition effects on protein conformation

    • Consider native-like nanodiscs or lipid cubic phase environments

  • Consensus building approaches:

    • Statistical analysis of multiple structural datasets

    • Bayesian integration of conflicting data

    • Meta-analysis of published structures

This comprehensive approach allows researchers to resolve contradictions by building a consensus view that incorporates diverse data sources and acknowledges the dynamic nature of membrane protein structures.

How can HtpX research contribute to understanding drug resistance in Mycobacterium tuberculosis?

HtpX research offers several avenues for investigating drug resistance mechanisms in Mycobacterium tuberculosis:

  • Membrane protein quality control: As HtpX participates in the proteolytic quality control of membrane proteins , alterations in its function may affect membrane integrity and permeability to antibiotics. Investigating these relationships could reveal new aspects of intrinsic resistance.

  • Stress response pathways: Being a heat shock protein , HtpX likely participates in stress response mechanisms that M. tuberculosis employs when exposed to antibiotics. Mapping these stress-response networks could identify new targets for combination therapies.

  • Mutation impacts: M. tuberculosis is prone to drug resistance through spontaneous mutation and mutation selection . Studying how mutations in HtpX or its interacting partners affect proteolytic function may reveal new resistance mechanisms.

  • Protein-protein interaction network: Analysis of HtpX's functional partners through STRING and similar tools can help map the broader protein quality control network in mycobacteria, potentially revealing key nodes that influence drug susceptibility.

  • Evolutionary insights: Phylogenetic analysis showing how HtpX variants cluster among related organisms may help trace the evolution of resistance mechanisms across mycobacterial species and strains.

By pursuing these research directions, scientists can gain valuable insights into how membrane protein quality control systems like HtpX contribute to the increasingly concerning problem of multi-resistant M. tuberculosis strains worldwide .

What are the best experimental designs for evaluating HtpX function in vivo?

Effective in vivo evaluation of HtpX function requires carefully designed experiments that account for its membrane localization and proteolytic activity:

  • Gene knockout and complementation studies:

    • Generate clean deletion mutants of htpX in model mycobacteria

    • Complement with wild-type and mutant variants

    • Evaluate growth under normal and stress conditions (heat shock, antibiotics)

    • Measure membrane integrity and protein quality control

  • Conditional expression systems:

    • Implement tetracycline-regulated or similar inducible systems

    • Allow titration of HtpX expression levels

    • Monitor effects of under/overexpression on cellular physiology

    • Time-course studies during infection models

  • Reporter fusion constructs:

    • Create HtpX-fluorescent protein fusions to track localization

    • Develop activity-based reporters for proteolytic function

    • Monitor expression and activity during infection

    • Use dual-reporter systems to correlate expression with stress responses

  • Animal infection models:

    • Compare wild-type and htpX mutant strains in appropriate animal models

    • Evaluate bacterial load, persistence, and host response

    • Histopathological analysis of infected tissues

    • Immune response profiling

  • Proteomics approach:

    • Quantitative proteomics comparing wild-type and htpX mutants

    • Identification of accumulated substrates in mutants

    • Membrane proteome analysis under various stress conditions

    • Correlation with transcriptomics data

These experimental designs would provide comprehensive insights into HtpX function in physiologically relevant conditions, revealing its importance in mycobacterial physiology and pathogenesis.

How can phylogenetic analysis of HtpX homologs inform evolutionary understanding of Mycobacterium species?

Phylogenetic analysis of HtpX homologs provides valuable insights into the evolutionary relationships among Mycobacterium species and related organisms:

  • Ancestral relationships: Computational studies have identified Polynucleobacter necessarius as an ancestral organism for selected HtpX homologs, with related organisms clustering together . This clustering suggests common evolutionary origins for HtpX-containing organisms.

  • Shared pathogenic strategies: The phylogenetic clustering indicates that related organisms might share common pathogenic strategies , providing a framework for understanding the evolution of virulence mechanisms across species.

  • Conservation mapping: By identifying conserved residues (19 conserved & exposed, 38 conserved & buried) , researchers can track the evolutionary pressure on different protein regions, distinguishing between structurally essential and functionally adaptive domains.

  • Horizontal gene transfer assessment: Phylogenetic incongruence between HtpX trees and species trees could reveal instances of horizontal gene transfer, potentially identifying cases where pathogenicity mechanisms have been shared between lineages.

  • Adaptation signatures: Comparing HtpX sequences across Mycobacterium species adapted to different hosts or environments can reveal signatures of selection, providing insights into how these bacteria have evolved to occupy different niches.

  • Co-evolution patterns: Analyzing the co-evolution of HtpX with its functional partners identified through STRING analysis can reveal coordinated evolutionary changes in protein interaction networks.

This evolutionary understanding not only illuminates the history of Mycobacterium species but also informs therapeutic development by identifying conserved targets and potential resistance mechanisms.

What emerging technologies could advance structural studies of HtpX?

Several cutting-edge technologies show promise for advancing our understanding of HtpX structure and function:

  • Cryo-electron tomography: This technique allows visualization of membrane proteins in their native cellular context, potentially revealing HtpX organization within the membrane and its interactions with other membrane components.

  • Single-particle cryo-EM: Recent advances in resolution now enable atomic-level structural determination of membrane proteins without crystallization, which has been challenging for proteins like HtpX .

  • Integrative structural biology: Combining multiple experimental techniques (X-ray crystallography, NMR, cryo-EM) with computational methods to build comprehensive structural models that capture dynamic aspects of HtpX function.

  • AlphaFold and related AI approaches: Deep learning methods for protein structure prediction have shown remarkable accuracy and could provide valuable structural insights for HtpX variants where experimental structures are unavailable.

  • Time-resolved structural methods: Techniques such as time-resolved X-ray crystallography or XFEL (X-ray Free Electron Laser) studies could capture HtpX in different functional states during its catalytic cycle.

  • Native mass spectrometry: Advanced MS techniques can analyze membrane proteins in near-native states, providing insights into HtpX oligomerization, substrate binding, and conformational changes.

These technologies could overcome current limitations in studying membrane metalloproteases like HtpX, potentially revealing new structural features that inform both basic understanding and therapeutic development.

How might HtpX research contribute to novel antimycobacterial therapeutic strategies?

HtpX research opens several promising avenues for novel antimycobacterial therapeutic development:

  • Direct inhibition strategies: Targeting the zinc metalloprotease activity of HtpX with small molecule inhibitors could disrupt membrane protein quality control, potentially compromising bacterial viability under stress conditions .

  • Membrane disruption: Understanding HtpX's role in membrane homeostasis could lead to compounds that synergize with existing antibiotics by compromising membrane integrity through HtpX inhibition.

  • Stress response modulation: As a heat shock protein , HtpX likely plays a role in stress adaptation. Therapeutics that prevent this adaptation could sensitize mycobacteria to host defense mechanisms and conventional antibiotics.

  • Vaccine development: The identification of conserved epitopes in HtpX through computational analysis provides potential targets for vaccine development, particularly the 19 conserved & exposed residues.

  • Combination therapy design: Understanding HtpX's protein-protein interaction network could reveal synergistic targets where simultaneous inhibition magnifies antimicrobial effects.

  • Host-directed therapies: Insights into how HtpX contributes to host-pathogen interactions might enable development of host-directed therapies that interfere with bacterial adaptation to the host environment.

By pursuing these research directions, scientists could develop more effective treatments for mycobacterial infections, including those caused by increasingly drug-resistant strains of M. tuberculosis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.