Recombinant Mycobacterium sp. UPF0060 membrane protein Mkms_2558 (Mkms_2558)

Shipped with Ice Packs
In Stock
Cat. No.
BT2475357
Source
in vitro E.coli expression system
Synonyms
Mkms_2558; UPF0060 membrane protein Mkms_2558
Quick Inquiry

Description

Overview of Recombinant Mycobacterium sp. UPF0060 Membrane Protein Mkms_2558 (Mkms_2558)

Recombinant Mycobacterium sp. UPF0060 membrane protein Mkms_2558 (Mkms_2558) is a protein expressed in E. coli and tagged with N-terminal His for identification and purification . It is derived from Mycobacterium sp. and is classified as a UPF0060 membrane protein . The full-length protein consists of 113 amino acids .

Basic Information

CategoryDescription
Official NameRecombinant Full Length Mycobacterium Sp. Upf0060 Membrane Protein Mkms_2558 (Mkms_2558) Protein, His-Tagged
Source (Host)E. coli
SpeciesMycobacterium sp.
TagHis
Protein LengthFull Length (1-113 aa)
AA SequenceMLTGVLVLKSAALFVLAALLEIGGAWLVWQGVREHRGWIWAGAGVIALGAYGFVAAFQPD AHFGRILAAYGGVFVAGSLLWGVVVDGFRPDRWDLTGALVCLVGVGLIMYAPR
PurityGreater than 90% as determined by SDS-PAGE
SynonymsMkms_2558; UPF0060 membrane protein Mkms_2558
UniProt IDA1UFZ7
Gene NameMkms_2558
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Production and Sourcing

The Mkms_2558 protein is produced as a recombinant protein in E. coli and can be purchased from various suppliers for research purposes . It is often supplied as a lyophilized powder and requires reconstitution in deionized sterile water .

Functional Aspects

The Mkms_2558 protein is predicted to be involved in several pathways and possess various biochemical functions, potentially cooperating with other proteins . These interactions are detectable through methods like yeast two-hybrid assays and co-immunoprecipitation .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and confirmed in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we will prioritize your specified tag type if provided.
Synonyms
Mkms_2558; UPF0060 membrane protein Mkms_2558
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Mycobacterium sp. (strain KMS)
Target Names
Mkms_2558
Target Protein Sequence
MLTGVLVLKSAALFVLAALLEIGGAWLVWQGVREHRGWIWAGAGVIALGAYGFVAAFQPD AHFGRILAAYGGVFVAGSLLWGVVVDGFRPDRWDLTGALVCLVGVGLIMYAPR
Uniprot No.
A1UFZ7

Target Background

Database Links

KEGG: mkm:Mkms_2558

Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.