Recombinant Mycobacterium sp. UPF0060 membrane protein Mmcs_2513 (Mmcs_2513)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Mmcs_2513; UPF0060 membrane protein Mmcs_2513
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Mycobacterium sp. (strain MCS)
Target Names
Mmcs_2513
Target Protein Sequence
MLTGVLVLKSAALFVLAALLEIGGAWLVWQGVREHRGWIWAGAGVIALGAYGFVAAFQPD AHFGRILAAYGGVFVAGSLLWGVVVDGFRPDRWDLTGALVCLVGVGLIMYAPR
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of UPF0060 membrane proteins in Mycobacterium species?

UPF0060 membrane proteins in Mycobacterium species typically feature transmembrane helices and potentially amphipathic helices similar to other mycobacterial membrane proteins. While the specific function of Mmcs_2513 remains under investigation, it belongs to a family of proteins with potential roles in membrane integrity, transport, or signaling pathways. Current structural predictions suggest multiple transmembrane segments with conserved domains across mycobacterial species. Like other membrane proteins, its structure is heavily influenced by its lipid environment, which has significant implications for both structure determination and functional characterization .

What expression systems are most effective for recombinant Mycobacterium membrane proteins?

For recombinant expression of mycobacterial membrane proteins like Mmcs_2513, several expression systems have demonstrated efficacy:

  • Mycobacterium smegmatis expression system: Often preferred due to its similar membrane composition and post-translational modification machinery to pathogenic mycobacteria, providing a more native-like environment .

  • E. coli-based systems: While commonly used for protein expression, these may require optimization for membrane proteins, including the use of specific strains (C41, C43, BL21) and fusion tags to improve expression and solubility.

  • Cell-free expression systems: Useful for toxic membrane proteins that might be challenging to express in cellular systems.

The choice of expression system should consider protein yield, proper folding, and downstream purification requirements. For Mmcs_2513, pilot experiments comparing expression levels and functionality across multiple systems are recommended before scaling up .

How should researchers optimize purification protocols for Mmcs_2513?

Purification of Mmcs_2513 requires careful consideration of membrane protein properties:

  • Solubilization: Begin with screening various detergents (DDM, LDAO, or CHAPS) at different concentrations to identify optimal solubilization conditions without protein denaturation.

  • Chromatography sequence: Typically involves:

    • Affinity chromatography (using His-tag or other fusion tags)

    • Size exclusion chromatography for oligomeric state determination

    • Ion exchange chromatography for further purification if needed

  • Detergent exchange: Consider exchanging harsh solubilization detergents with milder ones during purification to maintain protein stability.

  • Lipid supplementation: Addition of specific lipids during purification can help maintain native-like conformation, as demonstrated with other mycobacterial membrane proteins .

A systematic approach to optimization is critical, as membrane protein stability is highly dependent on surrounding lipid/detergent environments. Quality assessment using techniques like circular dichroism should be performed to confirm proper folding after purification .

What experimental design considerations are crucial when studying Mmcs_2513 structure-function relationships?

When designing experiments to investigate structure-function relationships of Mmcs_2513, several critical considerations must be addressed:

  • Lipid-to-protein ratios: Studies with the Influenza A M2 protein have demonstrated that higher lipid-to-protein ratios (1:120 to 1:240 range) can stabilize native conformations of membrane proteins. Similar approaches should be considered for Mmcs_2513 to ensure physiologically relevant structures are being studied .

  • Membrane mimetics selection: Choose appropriate membrane mimetics based on experimental objectives:

    • Detergent micelles for initial characterization

    • Nanodiscs or liposomes for more native-like environments

    • Bicelles for NMR studies

  • Factorial experimental design: Implement factorial or fractional factorial designs to efficiently test multiple variables affecting protein behavior, including:

    • pH conditions

    • Salt concentrations

    • Temperature stability

    • Lipid composition effects

  • Control experiments: Include controls with well-characterized mycobacterial membrane proteins to validate experimental approaches and provide comparative data .

The experimental design should follow rigorous statistical principles as outlined in modern experimental design approaches, including randomization, replication, and blocking when appropriate to minimize experimental bias and variability .

How can researchers effectively analyze the immune responses elicited by Mmcs_2513?

Analysis of immune responses to Mmcs_2513 should involve comprehensive assessment of both innate and adaptive immune parameters:

  • In vitro assessment:

    • PBMC stimulation assays measuring cytokine production (IFNγ, IL-12, TNF, IL-10)

    • Flow cytometry to identify responding cell populations

    • Transcriptomic analysis to determine activated pathways

  • In vivo models:

    • Mouse models examining antibody responses and T cell activation

    • Analysis of protection in challenge studies

    • Histopathological examination of relevant tissues

  • Cytokine profile analysis:

CytokineExpected Response to Mycobacterial ProteinsSignificance
IFNγOften decreased in infection-susceptible individualsCritical for intracellular mycobacteria control
IL-12Key for protective immunityDrives Th1 differentiation
TNFElevated in effective responsesRequired for granuloma formation
IL-10Elevated in some infection scenariosPotential immunoregulatory role
IL-17/IL-23May predict treatment outcomesImportant for mucosal immunity
  • Comparative analysis: Compare immune responses to Mmcs_2513 with those elicited by other mycobacterial antigens, particularly those with known immunomodulatory properties like HBHA .

Researchers should note that immune response patterns vary significantly between different mycobacterial species and strains, necessitating careful interpretation of results in the specific context of Mmcs_2513 .

What structural characterization methods are most appropriate for Mmcs_2513?

Multiple complementary approaches should be employed for comprehensive structural characterization of Mmcs_2513:

  • Solid-state NMR spectroscopy: Particularly valuable for membrane proteins, as demonstrated with the M2 protein studies. This approach allows characterization in lipid bilayers with varying lipid-to-protein ratios, which can reveal physiologically relevant conformations .

  • Cryo-electron microscopy: Increasingly powerful for membrane protein structure determination, especially for proteins like Mmcs_2513 that may form homo-oligomeric complexes.

  • X-ray crystallography: While challenging for membrane proteins, this remains valuable if crystals can be obtained, possibly using lipidic cubic phase approaches.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Useful for mapping solvent-accessible regions and identifying flexible protein domains.

  • Molecular dynamics simulations: Valuable for predicting protein behavior in different membrane environments and for hypothesis generation about functional mechanisms.

The choice of method should be guided by specific research questions. For example, if functional states of the protein involve conformational changes, solution NMR or HDX-MS might be more informative than crystallography. In most cases, combining multiple structural approaches provides the most complete characterization .

How can researchers develop fusion protein strategies involving Mmcs_2513 for enhancing immunogenicity?

Developing fusion protein strategies with Mmcs_2513 requires systematic design and validation:

  • Fusion partner selection:

    • Immunomodulatory cytokines (e.g., IL-12) can enhance Th1 responses as demonstrated with HBHA-hIL12 fusion constructs

    • Adjuvant proteins that enhance antigen presentation

    • Protein domains that improve solubility or expression

  • Fusion design considerations:

    • Orientation of fusion partners (N- or C-terminal fusions)

    • Inclusion of appropriate linker sequences to maintain independent folding

    • Preservation of key functional domains of both partners

  • Expression and purification optimization:

    • Test multiple expression systems to maximize yield of properly folded protein

    • Develop purification strategies that preserve structure and function

    • Validate biological activity of both protein components

  • Functional validation protocols:

    • In vitro activity assays for each component

    • Structural integrity assessment

    • Immunogenicity testing in appropriate model systems

The HBHA-hIL12 fusion protein expressed in M. smegmatis provides an excellent template for this approach. This construct demonstrated enhanced Th1-type cellular responses (IFNγ and IL-2) and provided protection equivalent to BCG vaccination in mouse models of tuberculosis .

What approaches should be used to study Mmcs_2513 interaction with host cell receptors?

To characterize Mmcs_2513 interactions with host receptors, employ a multi-faceted approach:

  • Protein-protein interaction screening:

    • Pull-down assays with potential host targets

    • Yeast two-hybrid or bacterial two-hybrid systems (with membrane adaptations)

    • Protein microarrays with host receptor libraries

  • Binding kinetics determination:

    • Surface plasmon resonance (SPR) for real-time binding analysis

    • Bio-layer interferometry for label-free interaction studies

    • Isothermal titration calorimetry for thermodynamic parameters

  • Functional validation:

    • Cell-based assays with receptor knockdowns

    • Competitive binding studies with known ligands

    • Mutagenesis of predicted interaction domains

  • Structural studies of complexes:

    • Co-crystallization attempts of Mmcs_2513 with identified binding partners

    • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

    • Computational docking validated by experimental constraints

When designing these studies, account for the membrane environment's influence on protein conformation and interaction surfaces. Consider reconstituting Mmcs_2513 in nanodiscs or liposomes for interaction studies to maintain native-like membrane contexts .

How should researchers design response surface experiments to optimize Mmcs_2513 expression and purification?

Response surface methodology (RSM) provides a powerful approach to systematically optimize Mmcs_2513 expression and purification conditions:

  • Experimental design setup:

    • Identify critical factors affecting expression/purification (e.g., temperature, inducer concentration, detergent type/concentration)

    • Create a central composite design (CCD) or Box-Behnken design

    • Include center points for model validation and assessment of experimental error

  • Implementation process:

FactorLow LevelMid LevelHigh Level
Induction temperature (°C)162537
IPTG concentration (mM)0.10.51.0
Post-induction time (hours)41224
Cell density at induction (OD600)0.40.81.2
Detergent concentration (× CMC)1510
  • Analysis approach:

    • Generate response surfaces using statistical software

    • Identify optimal regions for maximum protein yield and quality

    • Validate optimized conditions with confirmatory experiments

    • Use sequential optimization if necessary, narrowing factor ranges iteratively

  • Response measurements:

    • Protein yield quantification

    • Purity assessment via SDS-PAGE and densitometry

    • Functional activity measurements

    • Structural integrity via circular dichroism or thermal stability assays

This methodology streamlines optimization processes and provides statistical confidence in the results while minimizing experimental runs compared to one-factor-at-a-time approaches .

What are common challenges in Mmcs_2513 research and how can they be addressed?

Researchers studying Mmcs_2513 will likely encounter several common challenges:

  • Low expression yields:

    • Solution: Test alternative promoters, host strains, and fusion tags

    • Include molecular chaperones to aid proper folding

    • Optimize growth conditions using factorial design approaches

  • Protein aggregation:

    • Solution: Screen multiple detergents and lipid combinations

    • Implement on-column detergent exchange during purification

    • Consider native-like membrane mimetics such as nanodiscs

  • Functional activity loss:

    • Solution: Minimize purification steps and handling time

    • Include stabilizing agents specific to membrane proteins

    • Validate function at each purification stage

  • Structural heterogeneity:

    • Solution: Ensure adequate lipid-to-protein ratios (1:120 to 1:240)

    • Implement rigorous quality control via SEC-MALS or native PAGE

    • Consider higher lipid abundance to achieve native-like structure

  • Inconsistent immune response data:

    • Solution: Standardize antigen preparation protocols

    • Include multiple cytokine measurements for comprehensive assessment

    • Account for donor variability in human cell experiments

Systematic documentation of optimization attempts and outcomes will help build a knowledge base specific to Mmcs_2513 handling and characterization.

How can researchers effectively analyze contradictory data in Mmcs_2513 functional studies?

When faced with contradictory results in Mmcs_2513 functional studies:

  • Systematic assessment framework:

    • Evaluate methodological differences (expression systems, purification methods, assay conditions)

    • Compare protein preparation quality (purity, oligomeric state, lipid content)

    • Assess experimental variables (pH, temperature, buffer components)

  • Reconciliation strategies:

    • Design bridging studies that systematically vary conditions between contradictory protocols

    • Implement multiple orthogonal assays to measure the same functional parameter

    • Consider whether contradictions reflect different functional states rather than experimental error

  • Statistical approaches:

    • Conduct power analysis to ensure adequate sample sizes

    • Apply meta-analysis techniques to systematically compare data across studies

    • Implement appropriate statistical tests for specific experimental designs

  • Collaborative resolution:

    • Establish collaborations between labs with contradictory findings

    • Implement shared protocols with split sample analysis

    • Design round-robin testing to identify laboratory-specific variables

When analyzing contradictory immune response data specifically, note that variations in cytokine profiles between studies of mycobacterial proteins may reflect true biological variability rather than experimental error .

What validation strategies should be employed to confirm structural models of Mmcs_2513?

Robust validation of Mmcs_2513 structural models requires multiple complementary approaches:

The lessons from M2 protein research highlight the importance of validating membrane protein structures in environments with appropriate lipid abundance and composition to achieve physiologically relevant conformations .

What emerging technologies might advance Mmcs_2513 research in the next decade?

Several emerging technologies promise to transform membrane protein research applicable to Mmcs_2513:

  • Advanced structural biology approaches:

    • Micro-electron diffraction (MicroED) for structure determination from nanocrystals

    • Integrative structural biology combining multiple experimental constraints

    • Time-resolved cryo-EM to capture functional states

    • AI-powered structure prediction validated by sparse experimental data

  • Innovative membrane mimetics:

    • Next-generation nanodiscs with customizable size and lipid composition

    • Cell-derived membrane vesicles maintaining native lipid environments

    • 3D-bioprinted membranes for functional studies

    • Stimuli-responsive membrane systems for dynamic studies

  • Single-molecule techniques:

    • Advanced fluorescence approaches (FRET, FLIM) for conformational dynamics

    • Nanopore-based electrical recordings of single protein activity

    • High-speed AFM for observing conformational changes in real-time

    • Correlative light and electron microscopy at single-molecule resolution

  • Immune monitoring technologies:

    • Single-cell sequencing of immune responses to vaccination

    • Advanced cytokine profiling with higher sensitivity

    • Systems immunology approaches to identify correlates of protection

    • Precise immunophenotyping of responder versus non-responder populations

Researchers should remain alert to these technological developments as they may enable previously impossible experimental approaches to Mmcs_2513 characterization.

How might computational approaches enhance structure-function predictions for Mmcs_2513?

Computational approaches offer powerful tools for Mmcs_2513 research:

  • Advanced structural prediction:

    • Integration of AlphaFold/RoseTTAFold with membrane-specific refinement

    • Ensemble modeling to capture conformational diversity

    • Enhanced coevolutionary analysis for contact prediction

    • Hybrid methods incorporating sparse experimental constraints

  • Molecular dynamics applications:

    • Multiscale simulations spanning from quantum to coarse-grained levels

    • Enhanced sampling techniques to capture rare conformational transitions

    • Lipid-protein interaction mapping to identify critical boundary lipids

    • Free energy calculations for potential ligand binding

  • Systems biology integration:

    • Network analysis to predict functional pathways involving Mmcs_2513

    • Multi-omics data integration for contextualizing protein function

    • Comparative genomics across mycobacterial species for evolutionary insights

    • Host-pathogen interaction modeling based on structural information

  • Machine learning approaches:

    • Prediction of post-translational modifications and their functional impacts

    • Identification of potential interaction partners based on surface features

    • Classification of functional sites based on conservation and physicochemical properties

    • Automated literature mining to connect disparate findings across research areas

The integration of computational predictions with targeted experimental validation represents a powerful strategy for accelerating Mmcs_2513 research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.