Recombinant Mycobacterium sp. UPF0233 membrane protein Mjls_0012 (Mjls_0012)

Shipped with Ice Packs
In Stock
Cat. No.
BT2041666
Source
in vitro E.coli expression system
Synonyms
crgA; Mjls_0012; Cell division protein CrgA
Quick Inquiry

Description

Introduction to Recombinant Mycobacterium sp. UPF0233 Membrane Protein Mjls_0012

The recombinant Mycobacterium sp. UPF0233 membrane protein Mjls_0012 (UniProt ID: A3PSE8) is a full-length, His-tagged protein expressed in Escherichia coli. It belongs to the UPF0233 family, annotated as a cell division protein (CrgA) in mycobacteria . This protein spans 94 amino acids (1–94aa) and is characterized by its hydrophobic regions, suggesting a transmembrane structure .

Key Features of Mjls_0012

ParameterDetail
Source OrganismMycobacterium sp.
Expression SystemE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE validated)
FormLyophilized powder with 6% trehalose in Tris/PBS buffer (pH 8.0)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol recommended for storage
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles

The protein’s amino acid sequence includes a hydrophobic core (e.g., MPKSKVRKKNDFTISPVSRTPVKVKAGPSSVWFVALFVGLMLIGLIWLLVFQLAATNPVDAPGMLQWMADLGPWNYAIAFAFMITGLLLTMRWR) .

Role in Mycobacterial Biology

Mjls_0012 is annotated as a cell division protein (CrgA), though specific functional studies remain limited . UPF0233 homologs in other mycobacteria (e.g., Mycobacterium tuberculosis, Mycobacterium marinum) are similarly categorized as membrane proteins, suggesting conserved roles in cellular processes .

Comparative Analysis of UPF0233 Homologs

SpeciesGene DesignationFunction/Role
Mycobacterium sp.Mjls_0012Cell division (CrgA)
Mycobacterium marinumMMAR_0013Membrane protein (UPF0233 family)
Mycobacterium aviumMAV_0015Membrane protein (UPF0233 family)

While Mjls_0012 shares structural features with other UPF0233 proteins, its precise biochemical role (e.g., lipid transport, signaling) requires further investigation .

Recombinant Protein Utility

  • Structural Studies: His-tagged Mjls_0012 facilitates purification for X-ray crystallography or cryo-EM, enabling structural elucidation of UPF0233 family proteins .

  • Drug Targeting: Mycobacterial membrane proteins are critical for cell wall biogenesis and drug resistance. Recombinant Mjls_0012 could serve as a model for studying small-molecule interactions .

  • Vaccine Development: Membrane proteins are often immunogenic. Mjls_0012 may be evaluated as a candidate antigen in subunit vaccines, though no direct evidence exists .

Research Gaps and Future Directions

  1. Functional Elucidation:

    • Hypothesis: UPF0233 proteins may mediate membrane dynamics during cell division or stress responses.

    • Proposed Experiments:

      • Knockout studies in Mycobacterium sp.

      • Lipid-binding assays (analogous to MmpL3 studies )

  2. Evolutionary Analysis:

    • Phylogenetic comparison with UPF0233 homologs in M. tuberculosis, M. marinum, and M. avium to identify conserved motifs .

  3. Therapeutic Potential:

    • Screening for inhibitors targeting Mjls_0012 in Mycobacterium sp., leveraging its structural similarity to other membrane proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crgA; Mjls_0012; Cell division protein CrgA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-94
Protein Length
full length protein
Species
Mycobacterium sp. (strain JLS)
Target Names
crgA
Target Protein Sequence
MPKSKVRKKNDFTISPVSRTPVKVKAGPSSVWFVALFVGLMLIGLIWLLVFQLAATNPVD APGMLQWMADLGPWNYAIAFAFMITGLLLTMRWR
Uniprot No.
A3PSE8

Target Background

Function

Involved in cell division.

Database Links

KEGG: mjl:Mjls_0012

Protein Families
CrgA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.