Recombinant Mycobacterium sp. UPF0353 protein Mjls_2492 (Mjls_2492)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Mycobacterium sp. UPF0353 protein Mjls_2492 (Mjls_2492) is a protein expressed in E. coli and fused to an N-terminal His tag . It is a full-length protein consisting of 335 amino acids . The protein is available as a lyophilized powder with a purity greater than 90%, as determined by SDS-PAGE .

Table 1: Product Overview

FeatureDescription
Cat.No.RFL22378MF
Product OverviewRecombinant Full Length Mycobacterium sp. UPF0353 protein Mjls_2492 (Mjls_2492) Protein (A3PZE9) (1-335aa), fused to N-terminal His tag, was expressed in E. coli.
SpeciesMycobacterium sp.
SourceE. coli
TagHis
Protein LengthFull Length (1-335)
FormLyophilized powder
AA SequenceMTLPLLGPMSFSGFEHPWFFLFLIVVLALAGLYVIVALARQRRILRFANMELLESVAPNR PNRWRHLPAILLVASLVLLTVAMAGPTRDVRVPRNRAVVMLVIDVSQSMRATDVSPSRLA AAQEASKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKTAIDKLQLADRTATGEGI FTALQAIATVGAVIGGGDEPPPARIVLFSDGKETVPSNPDNPKGAFTAARTAKDQGVPIS TISFGTPYGYVEINEQRQPVPVDDQMLKKIADLSEGEAFTASSLEQLREVYANLQQQIGY ETIKGDASVGWLRLGALVLALSALAALLLNRRLPG
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Gene NameMjls_2492
SynonymsMjls_2492; UPF0353 protein Mjls_2492
UniProt IDA3PZE9

Biochemical Functions and Pathways

Mjls_2492 participates in various biochemical functions and pathways . These functions may be performed independently or in cooperation with other proteins . Although the precise functions and pathways are not detailed, information regarding related pathways and proteins can be found at Creative BioMart .

Interactions

Mjls_2492 interacts directly with other proteins and molecules, as identified through methods such as yeast two-hybrid assays, co-IP, and pull-down assays . Detailed information about these interactions can be found at Creative BioMart .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
Mjls_2492; UPF0353 protein Mjls_2492
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Mycobacterium sp. (strain JLS)
Target Names
Mjls_2492
Target Protein Sequence
MTLPLLGPMSFSGFEHPWFFLFLIVVLALAGLYVIVALARQRRILRFANMELLESVAPNR PNRWRHLPAILLVASLVLLTVAMAGPTRDVRVPRNRAVVMLVIDVSQSMRATDVSPSRLA AAQEASKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKTAIDKLQLADRTATGEGI FTALQAIATVGAVIGGGDEPPPARIVLFSDGKETVPSNPDNPKGAFTAARTAKDQGVPIS TISFGTPYGYVEINEQRQPVPVDDQMLKKIADLSEGEAFTASSLEQLREVYANLQQQIGY ETIKGDASVGWLRLGALVLALSALAALLLNRRLPG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0353 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mycobacterium sp. UPF0353 protein Mjls_2492 and what is its significance in research?

Mycobacterium sp. UPF0353 protein Mjls_2492 (UniProt ID: A3PZE9) is a full-length protein (335 amino acids) from Mycobacterium species. This protein belongs to the UPF0353 family, a group of uncharacterized proteins with potential functional significance in mycobacterial physiology.

Research significance stems from:

  • Its potential role in understanding mycobacterial biology and pathogenicity

  • Structural homology to proteins in pathogenic mycobacterial species

  • Opportunity to explore novel drug targets in mycobacterial infections

  • Contribution to understanding protein function across different mycobacterial species

When designing studies, researchers should consider comparative analyses with related proteins from pathogenic mycobacteria like M. tuberculosis to establish functional relationships that may have clinical relevance .

What expression systems are most effective for producing recombinant Mjls_2492 protein?

The optimal expression system for Mjls_2492 protein depends on research objectives and downstream applications. Based on available data:

E. coli Expression System (Most Commonly Used):

  • The recombinant Mjls_2492 protein has been successfully expressed in E. coli with N-terminal His-tag

  • Provides good protein yield for structural and functional studies

  • Recommended strain: BL21(DE3) for high expression levels

Methodological approach for optimizing expression:

  • Test multiple expression vectors (pET, pGEX, pMAL) to compare yield and solubility

  • Optimize induction conditions systematically:

    • IPTG concentration (0.1-1.0 mM)

    • Induction temperature (16°C, 25°C, 37°C)

    • Duration (4h, overnight, 24h)

  • Consider codon optimization for E. coli if expression levels are low

  • For membrane-associated regions, evaluate addition of solubilizing tags (MBP, SUMO, TrxA)

Alternative expression systems to consider:

  • Mycobacterial expression systems (M. smegmatis) for native-like post-translational modifications

  • Cell-free expression systems for rapid screening of functional domains

What are the optimal storage conditions for maintaining Mjls_2492 protein stability and activity?

Maintaining protein stability is critical for reliable experimental results. For Mjls_2492 protein:

Recommended storage conditions:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution, store at 4°C for up to one week for ongoing experiments

  • For long-term storage, add glycerol to 5-50% final concentration (50% recommended) and store at -20°C/-80°C

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

Reconstitution protocol:

  • Centrifuge vial briefly before opening to collect contents

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Ensure complete dissolution by gentle mixing

  • Prepare working aliquots based on experimental needs

Stability monitoring approach:

  • Evaluate protein stability using SDS-PAGE analysis of samples stored under different conditions

  • Implement activity assays specific to predicted protein function

  • Use thermal shift assays to assess buffer conditions that maximize stability

  • Consider circular dichroism to monitor structural integrity over time

How can I design experiments to determine the function of Mjls_2492 protein in mycobacterial biology?

Determining the function of uncharacterized proteins like Mjls_2492 requires a systematic, multi-faceted approach:

Comprehensive experimental design strategy:

  • Bioinformatic analysis pipeline:

    • Perform phylogenetic analysis with other UPF0353 family proteins

    • Use structural prediction tools to identify potential functional domains

    • Apply gene neighborhood analysis to identify functionally related genes

    • Search for conserved motifs across mycobacterial species

  • Gene knockout/knockdown studies:

    • Generate Mjls_2492 deletion mutants in model mycobacterial species

    • Implement CRISPR interference or antisense RNA for conditional knockdown

    • Perform comprehensive phenotypic analysis (growth curves, stress responses)

    • Conduct complementation studies to confirm phenotype specificity

  • Protein interaction studies:

    • Use bacterial two-hybrid systems for protein-protein interaction screening

    • Perform co-immunoprecipitation with tagged Mjls_2492

    • Validate interactions with pull-down assays using purified components

    • Consider proximity-labeling approaches (BioID, APEX) in mycobacterial models

  • Localization studies:

    • Generate fluorescent protein fusions (N- and C-terminal)

    • Perform subcellular fractionation followed by Western blotting

    • Use immunoelectron microscopy for high-resolution localization

    • Consider dynamic localization studies under different growth conditions

  • Functional assays based on predicted properties:

    • If membrane-associated, assess membrane integrity and transport functions

    • If predicted enzymatic activity, design appropriate biochemical assays

    • Evaluate role in stress responses (oxidative, acidic, nutrient limitation)

What approaches can be used to study potential interactions between Mjls_2492 and other mycobacterial proteins?

Investigating protein-protein interactions is essential for understanding Mjls_2492's functional context within mycobacterial biology:

Comprehensive interaction mapping methodology:

  • In vitro interaction studies:

    • Perform pull-down assays with purified His-tagged Mjls_2492

    • Use surface plasmon resonance (SPR) to quantify binding kinetics

    • Implement isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Conduct crosslinking studies followed by mass spectrometry

  • Cell-based interaction screening:

    • Apply bacterial two-hybrid system screening against mycobacterial genomic library

    • Use split-protein complementation assays for validation

    • Implement co-immunoprecipitation from mycobacterial lysates

    • Consider proximity-dependent biotinylation in mycobacterial models

  • Structural approaches for interaction characterization:

    • Perform hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Use NMR spectroscopy for detecting weak/transient interactions

    • Consider X-ray crystallography of protein complexes

    • Implement molecular modeling and docking studies with predicted partners

  • Functional validation of interactions:

    • Design competition assays with peptides derived from interaction interfaces

    • Generate interaction-deficient mutants through site-directed mutagenesis

    • Assess phenotypic consequences of disrupting specific interactions

    • Use transcriptomics/proteomics to identify downstream effects of disrupted interactions

How should I design experiments to compare wildtype and mutant forms of Mjls_2492 protein?

Systematic experimental design approach:

  • Mutation strategy design:

    • Identify conserved residues across UPF0353 family for targeted mutagenesis

    • Design alanine-scanning mutagenesis for functional domain mapping

    • Create truncation mutants to assess domain contributions

    • Consider chimeric proteins with homologous UPF0353 family members

  • Expression system considerations:

    • Express wildtype and mutant proteins using identical systems and conditions

    • Validate equivalent expression levels using Western blot analysis

    • Ensure comparable purity and yield through optimized purification protocols

    • Verify proper folding using circular dichroism or limited proteolysis

  • Comparative analysis framework:

    ParameterWildtype ControlMutant VariantsAnalysis Method
    Structural integrityBaseline measurementComparative measurementCD spectroscopy, thermal shift assay
    Subcellular localizationNative patternAltered pattern?Fractionation, microscopy
    Protein stabilityStandard half-lifeChanged half-life?Pulse-chase, thermal denaturation
    Interaction profileStandard interactomeModified interactions?Pull-down, Y2H, BioID
    Functional activityBaseline activityRetained/lost activity?Custom functional assays
  • Statistical design considerations:

    • Determine appropriate sample size using power analysis

    • Include technical replicates (n≥3) and biological replicates (n≥3)

    • Implement appropriate statistical tests for data analysis

    • Consider non-parametric tests if normal distribution cannot be confirmed

  • Controls and validation:

    • Include positive and negative controls specific to each assay

    • Validate key findings using complementary approaches

    • Consider rescue experiments to confirm specificity of observed effects

    • Implement blinding procedures where appropriate

What are the most appropriate statistical methods for analyzing data from Mjls_2492 functional studies?

Comprehensive statistical analysis framework:

  • Preliminary data assessment:

    • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Evaluate homogeneity of variance using Levene's or Bartlett's tests

    • Identify and address outliers using standardized residuals or Cook's distance

    • Consider data transformations if assumptions are violated

  • Statistical methods selection guide:

    Experimental DesignAppropriate TestsConsiderations
    Two group comparisonStudent's t-test (parametric)
    Mann-Whitney U test (non-parametric)
    Use paired tests for matched samples
    Multiple group comparisonOne-way ANOVA with post-hoc tests (parametric)
    Kruskal-Wallis with Dunn's test (non-parametric)
    Correct for multiple comparisons (Bonferroni, Tukey, FDR)
    Time-course experimentsRepeated measures ANOVA
    Mixed-effects models
    Account for missing timepoints
    Dose-response studiesNonlinear regression
    EC50/IC50 determination
    Compare curve parameters statistically
    Correlation studiesPearson's r (linear, parametric)
    Spearman's rho (rank-based, non-parametric)
    Test significance of correlation coefficient
  • Advanced statistical approaches:

    • Apply multivariate analysis for complex datasets (PCA, clustering)

    • Consider machine learning approaches for pattern recognition

    • Implement Bayesian statistics for integrating prior knowledge

    • Use meta-analysis techniques when combining multiple experiments

  • Reporting standards:

    • Include exact p-values rather than significance thresholds

    • Report effect sizes alongside significance testing

    • Present confidence intervals to indicate precision

    • Document all statistical tests, software, and versions used

  • Reproducibility considerations:

    • Implement pre-registration of analysis plans when possible

    • Perform sensitivity analyses with alternative statistical approaches

    • Consider blind re-analysis by independent researcher

    • Share raw data and analysis code when publishing

What strategies can be employed when encountering expression or solubility issues with Mjls_2492 protein?

Mycobacterial proteins like Mjls_2492 can present significant challenges in expression and solubility. Here's a systematic troubleshooting approach:

Comprehensive troubleshooting methodology:

  • Expression troubleshooting decision tree:

    • Low expression levels:

      • Optimize codon usage for expression host

      • Test alternative promoters (T7, tac, araBAD)

      • Evaluate different E. coli strains (BL21, Rosetta, Arctic Express)

      • Adjust induction parameters (temperature, IPTG concentration, duration)

    • Protein toxicity issues:

      • Use tight expression control systems (pET with T7 lysozyme)

      • Implement glucose repression for leaky promoters

      • Consider cell-free expression systems

      • Test inducible secretion systems

  • Solubility enhancement strategies:

    ApproachMethodologyConsiderations
    Fusion tagsTest MBP, GST, SUMO, or TrxA tagsAssess impact on downstream applications
    Buffer optimizationSystematic screen of pH, salt, additivesDesign using fractional factorial approach
    Co-expression partnersExpress with chaperones (GroEL/ES, DnaK)Consider mycobacterial-specific chaperones
    Refolding protocolsDenaturant gradient dialysisOptimize protein concentration and temperature
    Detergent screeningTest non-ionic, zwitterionic detergentsConsider impact on structural integrity
  • Domain-based approaches:

    • Identify soluble domains through bioinformatic prediction

    • Create truncation constructs targeting predicted domains

    • Consider domain expression as separate constructs

    • Use domain-swapping with soluble homologs

  • Alternative expression systems:

    • Test mycobacterial expression systems (M. smegmatis)

    • Consider gram-positive hosts (B. subtilis)

    • Evaluate eukaryotic systems for complex proteins

    • Implement cell-free expression systems for rapid screening

How can I optimize experimental conditions for studying Mjls_2492 interactions with membrane components?

The hydrophobic regions in Mjls_2492 suggest potential membrane interactions, requiring specialized approaches:

Membrane interaction study optimization:

  • Membrane protein extraction optimization:

    • Develop a systematic detergent screening protocol:

      • Test mild non-ionic detergents (DDM, LMNG)

      • Evaluate zwitterionic detergents (CHAPS, Fos-choline)

      • Consider native nanodiscs or SMALPs for extraction

    • Optimize extraction conditions (temperature, time, detergent concentration)

    • Validate extraction efficiency using Western blotting

    • Assess protein activity/folding after extraction

  • Membrane interaction characterization approaches:

    TechniqueApplicationOptimization Parameters
    Liposome binding assaysQuantify membrane associationLipid composition, protein:lipid ratio, buffer conditions
    Fluorescence spectroscopyMonitor conformational changesProbe selection, protein concentration, spectral parameters
    Surface plasmon resonanceBinding kinetics quantificationSurface chemistry, flow rate, regeneration conditions
    Microscale thermophoresisInteraction affinity measurementLabeling strategy, concentration range, buffer optimization
  • Reconstitution strategies:

    • Develop protocols for reconstitution in model membranes:

      • Liposomes of varying composition

      • Nanodiscs with defined lipid composition

      • Supported lipid bilayers for surface-based assays

    • Optimize protein:lipid ratios systematically

    • Validate functional reconstitution through activity assays

    • Consider co-reconstitution with potential interaction partners

  • Structural studies of membrane-associated forms:

    • Cryo-electron microscopy of membrane-embedded protein

    • Solid-state NMR of reconstituted samples

    • Hydrogen-deuterium exchange mass spectrometry to map interfaces

    • Molecular dynamics simulations of membrane association

How should I approach comparative analysis between Mjls_2492 and homologous proteins from other mycobacterial species?

Comparative analysis provides crucial insights into protein function and evolution. For Mjls_2492:

Systematic comparative analysis framework:

  • Sequence-based comparative approach:

    • Perform comprehensive homology searches across mycobacterial genomes

    • Construct multiple sequence alignments using MUSCLE or MAFFT

    • Generate phylogenetic trees using maximum likelihood or Bayesian methods

    • Identify conserved residues and domains across mycobacterial species

    • Map conservation onto predicted structural models

  • Structure-based comparative analysis:

    • Generate structural models of homologs using AlphaFold or similar tools

    • Perform structural superposition to identify conserved spatial features

    • Calculate root mean square deviation (RMSD) between structures

    • Identify structurally conserved regions that may indicate functional sites

    • Compare electrostatic surface properties across homologs

  • Functional comparison methodology:

    AspectAnalysis ApproachInterpretation Framework
    Expression patternsCompare expression data across speciesIdentify common regulatory patterns
    Genomic contextAnalyze gene neighborhoods across speciesInfer functional associations from conserved operons
    Interaction networksCompare known interactors across speciesIdentify conserved interaction modules
    Phenotypic effectsCompare knockout phenotypes where availableDetermine functional conservation across species
  • Evolutionary analysis integration:

    • Calculate selection pressure (dN/dS) across protein sequences

    • Identify sites under positive or purifying selection

    • Correlate evolutionary rates with structural/functional domains

    • Apply coevolution analysis to identify functionally linked residues

  • Translational relevance assessment:

    • Compare with homologs from pathogenic mycobacteria

    • Identify unique features that could be exploited therapeutically

    • Evaluate potential as a drug target based on conservation pattern

    • Assess immunogenic potential across species

What bioinformatic approaches can predict potential functions of Mjls_2492 based on sequence and structural features?

Bioinformatic prediction can guide functional characterization of Mjls_2492:

Comprehensive function prediction methodology:

  • Sequence-based function prediction:

    • Implement PSI-BLAST and HHpred for remote homology detection

    • Apply motif scanning using PROSITE, PRINTS, and PFAM databases

    • Utilize gene ontology prediction tools (InterProScan, PANNZER)

    • Perform transmembrane topology prediction (TMHMM, Phobius)

    • Apply signal peptide prediction (SignalP) and subcellular localization tools

  • Structure-based function prediction:

    • Generate structural models using AlphaFold or Rosetta

    • Implement fold recognition through DALI or TM-align

    • Perform active site prediction using CASTp or POCASA

    • Apply ligand binding site prediction (FTSite, SiteMap)

    • Utilize molecular docking to test potential substrates/ligands

  • Integrated prediction approaches:

    MethodApplicationInterpretation Strategy
    Genomic context analysisFunction inference from operonic structureIdentify functionally related gene clusters
    Protein-protein interaction predictionInteractome constructionMap potential functional pathways
    Coevolution analysisIdentification of functionally coupled residuesGuide mutagenesis experiments
    Integrative scoring systemsConfidence assessment of predictionsPrioritize hypotheses for experimental validation
  • Machine learning integration:

    • Apply supervised learning approaches with known UPF0353 family members

    • Implement feature extraction from sequence and structural properties

    • Utilize ensemble methods to improve prediction accuracy

    • Consider deep learning approaches for complex pattern recognition

  • Experimental validation design:

    • Prioritize predictions based on confidence scores

    • Design targeted assays to test specific functional hypotheses

    • Develop high-throughput screening approaches for multiple predictions

    • Implement systematic validation frameworks with positive controls

How can findings about Mjls_2492 be integrated with broader understanding of mycobacterial biology?

Contextualizing Mjls_2492 research within the broader field of mycobacterial biology:

Context integration methodology:

  • Pathway integration approach:

    • Map Mjls_2492 function to known mycobacterial metabolic pathways

    • Integrate with transcriptomic/proteomic datasets from mycobacterial studies

    • Connect to signaling networks through interaction mapping

    • Analyze regulation patterns under different environmental conditions

  • Physiological context framework:

    • Relate function to mycobacterial cell envelope biology

    • Connect to stress response mechanisms if applicable

    • Integrate with persistence/dormancy mechanisms

    • Evaluate contribution to virulence or host interaction

  • Evolutionary context analysis:

    • Determine conservation across mycobacterial species

    • Identify potential horizontal gene transfer events

    • Analyze selection pressure in different mycobacterial lineages

    • Compare with homologs in other actinobacterial genera

  • Translational significance evaluation:

    Application AreaIntegration ApproachImpact Assessment
    Drug discoveryTarget validation frameworkEssentiality, druggability, resistance potential
    Diagnostic developmentBiomarker potential analysisSpecificity, expression levels, accessibility
    Vaccine researchImmunogenicity evaluationConservation, surface exposure, immune response
    Synthetic biologyEngineering application assessmentModularity, orthogonality, functional predictability
  • Collaborative research framework:

    • Identify complementary expertise for comprehensive characterization

    • Develop standardized protocols for cross-laboratory validation

    • Implement data sharing strategies for integrated analysis

    • Design collaborative projects addressing multifaceted questions

What are the common pitfalls in interpreting results from recombinant protein studies and how can they be avoided?

Avoiding misinterpretation in recombinant protein studies:

Comprehensive interpretation framework:

  • Expression artifact identification:

    • Compare properties between native and recombinant proteins:

      • Post-translational modifications

      • Subcellular localization

      • Oligomerization state

      • Activity levels

    • Validate key findings in native expression systems

    • Consider impact of tags on protein function

    • Evaluate effects of overexpression on observed phenotypes

  • Experimental design validation:

    • Implement appropriate controls for each experiment type:

      • Negative controls (empty vector, inactive mutants)

      • Positive controls (well-characterized proteins)

      • Internal controls for normalization

    • Ensure biological relevance of experimental conditions

    • Validate key findings using complementary approaches

    • Consider physiological concentrations in interaction studies

  • Data interpretation safeguards:

    Potential PitfallPrevention StrategyValidation Approach
    Correlation-causation confusionDesign mechanistic studiesImplement intervention experiments
    Overlooking alternative explanationsSystematic hypothesis testingConsider multiple models for observations
    Confirmation biasBlinded experimental designIndependent validation by collaborators
    Statistical overinterpretationAppropriate statistical methodsMultiple testing correction, effect size analysis
  • Replication and validation:

    • Implement both technical and biological replicates

    • Verify critical findings with alternative methods

    • Consider independent validation in different laboratories

    • Test robustness across different experimental conditions

  • Transparent reporting:

    • Document all experimental conditions thoroughly

    • Report negative and inconclusive results

    • Acknowledge limitations of experimental approaches

    • Present alternative interpretations of complex data

What are the most promising research directions for further characterizing Mjls_2492 function in mycobacterial biology?

Future research on Mjls_2492 should focus on systematic characterization and integration with broader mycobacterial biology:

Priority research directions:

  • Comprehensive functional characterization:

    • Complete structural determination through X-ray crystallography or cryo-EM

    • Implement systematic mutagenesis to map functional domains

    • Develop specific activity assays based on predicted functions

    • Establish in vivo models to assess physiological relevance

  • Systems biology integration:

    • Construct comprehensive interaction networks

    • Perform multi-omics analysis of knockout/knockdown strains

    • Map regulatory networks controlling expression

    • Develop mathematical models of associated biological processes

  • Comparative biology approaches:

    • Extend studies to homologs in pathogenic mycobacteria

    • Implement cross-species complementation studies

    • Evaluate evolutionary patterns across mycobacterial lineages

    • Identify species-specific adaptations in protein function

  • Translational research opportunities:

    • Assess potential as antimycobacterial drug target

    • Evaluate immunogenicity for vaccine development

    • Explore biotechnological applications based on function

    • Develop diagnostic applications if species-specific features exist

  • Methodological innovations:

    • Develop improved expression systems for difficult mycobacterial proteins

    • Implement advanced imaging approaches for localization studies

    • Apply emerging structural biology methods for dynamic analysis

    • Explore synthetic biology approaches for functional characterization

How can collaborative approaches enhance our understanding of UPF0353 family proteins across different mycobacterial species?

Collaborative research frameworks offer powerful approaches for comprehensive characterization:

Collaborative research strategy:

  • Consortium-based research model:

    • Establish multi-laboratory collaborations with complementary expertise:

      • Structural biology

      • Biochemistry and enzymology

      • Microbial genetics

      • Systems biology

      • Computational biology

    • Implement standardized protocols across laboratories

    • Develop central data repositories for integrated analysis

    • Coordinate research priorities and resource allocation

  • Resource sharing framework:

    • Establish repositories for plasmids, strains, and protein samples

    • Develop shared computational resources for bioinformatic analysis

    • Implement common data standards for interoperability

    • Create protocol repositories with detailed methodologies

  • Integrated research approaches:

    Collaborative ApproachImplementation StrategyExpected Outcome
    Parallel characterizationSimultaneous study of homologs across speciesComprehensive functional comparison
    Functional screeningDistributed high-throughput assay developmentRapid functional hypothesis testing
    Multi-omics integrationCoordinated datasets across speciesSystems-level understanding of protein role
    Evolutionary analysisComprehensive sampling across mycobacterial phylogenyEvolutionary context of protein function
  • Knowledge synthesis framework:

    • Implement regular collaborative reviews and meta-analyses

    • Develop integrated databases for UPF0353 family proteins

    • Create predictive models incorporating multi-species data

    • Establish consensus nomenclature and functional classification

  • Training and capacity building:

    • Develop training programs for specialized techniques

    • Implement researcher exchanges between laboratories

    • Create educational resources for new researchers

    • Establish mentoring networks for early-career scientists

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.