Recombinant Mycobacterium sp. UPF0353 protein Mjls_2492 (Mjls_2492) is a protein expressed in E. coli and fused to an N-terminal His tag . It is a full-length protein consisting of 335 amino acids . The protein is available as a lyophilized powder with a purity greater than 90%, as determined by SDS-PAGE .
| Feature | Description |
|---|---|
| Cat.No. | RFL22378MF |
| Product Overview | Recombinant Full Length Mycobacterium sp. UPF0353 protein Mjls_2492 (Mjls_2492) Protein (A3PZE9) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
| Species | Mycobacterium sp. |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-335) |
| Form | Lyophilized powder |
| AA Sequence | MTLPLLGPMSFSGFEHPWFFLFLIVVLALAGLYVIVALARQRRILRFANMELLESVAPNR PNRWRHLPAILLVASLVLLTVAMAGPTRDVRVPRNRAVVMLVIDVSQSMRATDVSPSRLA AAQEASKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKTAIDKLQLADRTATGEGI FTALQAIATVGAVIGGGDEPPPARIVLFSDGKETVPSNPDNPKGAFTAARTAKDQGVPIS TISFGTPYGYVEINEQRQPVPVDDQMLKKIADLSEGEAFTASSLEQLREVYANLQQQIGY ETIKGDASVGWLRLGALVLALSALAALLLNRRLPG |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles. |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Gene Name | Mjls_2492 |
| Synonyms | Mjls_2492; UPF0353 protein Mjls_2492 |
| UniProt ID | A3PZE9 |
Mjls_2492 participates in various biochemical functions and pathways . These functions may be performed independently or in cooperation with other proteins . Although the precise functions and pathways are not detailed, information regarding related pathways and proteins can be found at Creative BioMart .
Mjls_2492 interacts directly with other proteins and molecules, as identified through methods such as yeast two-hybrid assays, co-IP, and pull-down assays . Detailed information about these interactions can be found at Creative BioMart .
KEGG: mjl:Mjls_2492
Mycobacterium sp. UPF0353 protein Mjls_2492 (UniProt ID: A3PZE9) is a full-length protein (335 amino acids) from Mycobacterium species. This protein belongs to the UPF0353 family, a group of uncharacterized proteins with potential functional significance in mycobacterial physiology.
Research significance stems from:
Its potential role in understanding mycobacterial biology and pathogenicity
Structural homology to proteins in pathogenic mycobacterial species
Opportunity to explore novel drug targets in mycobacterial infections
Contribution to understanding protein function across different mycobacterial species
When designing studies, researchers should consider comparative analyses with related proteins from pathogenic mycobacteria like M. tuberculosis to establish functional relationships that may have clinical relevance .
The optimal expression system for Mjls_2492 protein depends on research objectives and downstream applications. Based on available data:
E. coli Expression System (Most Commonly Used):
The recombinant Mjls_2492 protein has been successfully expressed in E. coli with N-terminal His-tag
Provides good protein yield for structural and functional studies
Recommended strain: BL21(DE3) for high expression levels
Methodological approach for optimizing expression:
Test multiple expression vectors (pET, pGEX, pMAL) to compare yield and solubility
Optimize induction conditions systematically:
IPTG concentration (0.1-1.0 mM)
Induction temperature (16°C, 25°C, 37°C)
Duration (4h, overnight, 24h)
Consider codon optimization for E. coli if expression levels are low
For membrane-associated regions, evaluate addition of solubilizing tags (MBP, SUMO, TrxA)
Alternative expression systems to consider:
Mycobacterial expression systems (M. smegmatis) for native-like post-translational modifications
Cell-free expression systems for rapid screening of functional domains
Maintaining protein stability is critical for reliable experimental results. For Mjls_2492 protein:
Recommended storage conditions:
Store lyophilized protein at -20°C/-80°C upon receipt
After reconstitution, store at 4°C for up to one week for ongoing experiments
For long-term storage, add glycerol to 5-50% final concentration (50% recommended) and store at -20°C/-80°C
Aliquot reconstituted protein to avoid repeated freeze-thaw cycles
Reconstitution protocol:
Centrifuge vial briefly before opening to collect contents
Reconstitute in deionized sterile water to 0.1-1.0 mg/mL
Ensure complete dissolution by gentle mixing
Prepare working aliquots based on experimental needs
Stability monitoring approach:
Evaluate protein stability using SDS-PAGE analysis of samples stored under different conditions
Implement activity assays specific to predicted protein function
Use thermal shift assays to assess buffer conditions that maximize stability
Consider circular dichroism to monitor structural integrity over time
Determining the function of uncharacterized proteins like Mjls_2492 requires a systematic, multi-faceted approach:
Comprehensive experimental design strategy:
Bioinformatic analysis pipeline:
Perform phylogenetic analysis with other UPF0353 family proteins
Use structural prediction tools to identify potential functional domains
Apply gene neighborhood analysis to identify functionally related genes
Search for conserved motifs across mycobacterial species
Gene knockout/knockdown studies:
Generate Mjls_2492 deletion mutants in model mycobacterial species
Implement CRISPR interference or antisense RNA for conditional knockdown
Perform comprehensive phenotypic analysis (growth curves, stress responses)
Conduct complementation studies to confirm phenotype specificity
Protein interaction studies:
Use bacterial two-hybrid systems for protein-protein interaction screening
Perform co-immunoprecipitation with tagged Mjls_2492
Validate interactions with pull-down assays using purified components
Consider proximity-labeling approaches (BioID, APEX) in mycobacterial models
Localization studies:
Generate fluorescent protein fusions (N- and C-terminal)
Perform subcellular fractionation followed by Western blotting
Use immunoelectron microscopy for high-resolution localization
Consider dynamic localization studies under different growth conditions
Functional assays based on predicted properties:
Investigating protein-protein interactions is essential for understanding Mjls_2492's functional context within mycobacterial biology:
Comprehensive interaction mapping methodology:
In vitro interaction studies:
Perform pull-down assays with purified His-tagged Mjls_2492
Use surface plasmon resonance (SPR) to quantify binding kinetics
Implement isothermal titration calorimetry (ITC) for thermodynamic parameters
Conduct crosslinking studies followed by mass spectrometry
Cell-based interaction screening:
Apply bacterial two-hybrid system screening against mycobacterial genomic library
Use split-protein complementation assays for validation
Implement co-immunoprecipitation from mycobacterial lysates
Consider proximity-dependent biotinylation in mycobacterial models
Structural approaches for interaction characterization:
Perform hydrogen-deuterium exchange mass spectrometry to map interaction interfaces
Use NMR spectroscopy for detecting weak/transient interactions
Consider X-ray crystallography of protein complexes
Implement molecular modeling and docking studies with predicted partners
Functional validation of interactions:
Design competition assays with peptides derived from interaction interfaces
Generate interaction-deficient mutants through site-directed mutagenesis
Assess phenotypic consequences of disrupting specific interactions
Use transcriptomics/proteomics to identify downstream effects of disrupted interactions
Systematic experimental design approach:
Mutation strategy design:
Identify conserved residues across UPF0353 family for targeted mutagenesis
Design alanine-scanning mutagenesis for functional domain mapping
Create truncation mutants to assess domain contributions
Consider chimeric proteins with homologous UPF0353 family members
Expression system considerations:
Express wildtype and mutant proteins using identical systems and conditions
Validate equivalent expression levels using Western blot analysis
Ensure comparable purity and yield through optimized purification protocols
Verify proper folding using circular dichroism or limited proteolysis
Comparative analysis framework:
| Parameter | Wildtype Control | Mutant Variants | Analysis Method |
|---|---|---|---|
| Structural integrity | Baseline measurement | Comparative measurement | CD spectroscopy, thermal shift assay |
| Subcellular localization | Native pattern | Altered pattern? | Fractionation, microscopy |
| Protein stability | Standard half-life | Changed half-life? | Pulse-chase, thermal denaturation |
| Interaction profile | Standard interactome | Modified interactions? | Pull-down, Y2H, BioID |
| Functional activity | Baseline activity | Retained/lost activity? | Custom functional assays |
Statistical design considerations:
Determine appropriate sample size using power analysis
Include technical replicates (n≥3) and biological replicates (n≥3)
Implement appropriate statistical tests for data analysis
Consider non-parametric tests if normal distribution cannot be confirmed
Controls and validation:
Comprehensive statistical analysis framework:
Preliminary data assessment:
Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests
Evaluate homogeneity of variance using Levene's or Bartlett's tests
Identify and address outliers using standardized residuals or Cook's distance
Consider data transformations if assumptions are violated
Statistical methods selection guide:
| Experimental Design | Appropriate Tests | Considerations |
|---|---|---|
| Two group comparison | Student's t-test (parametric) Mann-Whitney U test (non-parametric) | Use paired tests for matched samples |
| Multiple group comparison | One-way ANOVA with post-hoc tests (parametric) Kruskal-Wallis with Dunn's test (non-parametric) | Correct for multiple comparisons (Bonferroni, Tukey, FDR) |
| Time-course experiments | Repeated measures ANOVA Mixed-effects models | Account for missing timepoints |
| Dose-response studies | Nonlinear regression EC50/IC50 determination | Compare curve parameters statistically |
| Correlation studies | Pearson's r (linear, parametric) Spearman's rho (rank-based, non-parametric) | Test significance of correlation coefficient |
Advanced statistical approaches:
Apply multivariate analysis for complex datasets (PCA, clustering)
Consider machine learning approaches for pattern recognition
Implement Bayesian statistics for integrating prior knowledge
Use meta-analysis techniques when combining multiple experiments
Reporting standards:
Include exact p-values rather than significance thresholds
Report effect sizes alongside significance testing
Present confidence intervals to indicate precision
Document all statistical tests, software, and versions used
Reproducibility considerations:
Mycobacterial proteins like Mjls_2492 can present significant challenges in expression and solubility. Here's a systematic troubleshooting approach:
Comprehensive troubleshooting methodology:
Expression troubleshooting decision tree:
Low expression levels:
Optimize codon usage for expression host
Test alternative promoters (T7, tac, araBAD)
Evaluate different E. coli strains (BL21, Rosetta, Arctic Express)
Adjust induction parameters (temperature, IPTG concentration, duration)
Protein toxicity issues:
Use tight expression control systems (pET with T7 lysozyme)
Implement glucose repression for leaky promoters
Consider cell-free expression systems
Test inducible secretion systems
Solubility enhancement strategies:
| Approach | Methodology | Considerations |
|---|---|---|
| Fusion tags | Test MBP, GST, SUMO, or TrxA tags | Assess impact on downstream applications |
| Buffer optimization | Systematic screen of pH, salt, additives | Design using fractional factorial approach |
| Co-expression partners | Express with chaperones (GroEL/ES, DnaK) | Consider mycobacterial-specific chaperones |
| Refolding protocols | Denaturant gradient dialysis | Optimize protein concentration and temperature |
| Detergent screening | Test non-ionic, zwitterionic detergents | Consider impact on structural integrity |
Domain-based approaches:
Identify soluble domains through bioinformatic prediction
Create truncation constructs targeting predicted domains
Consider domain expression as separate constructs
Use domain-swapping with soluble homologs
Alternative expression systems:
The hydrophobic regions in Mjls_2492 suggest potential membrane interactions, requiring specialized approaches:
Membrane interaction study optimization:
Membrane protein extraction optimization:
Develop a systematic detergent screening protocol:
Test mild non-ionic detergents (DDM, LMNG)
Evaluate zwitterionic detergents (CHAPS, Fos-choline)
Consider native nanodiscs or SMALPs for extraction
Optimize extraction conditions (temperature, time, detergent concentration)
Validate extraction efficiency using Western blotting
Assess protein activity/folding after extraction
Membrane interaction characterization approaches:
| Technique | Application | Optimization Parameters |
|---|---|---|
| Liposome binding assays | Quantify membrane association | Lipid composition, protein:lipid ratio, buffer conditions |
| Fluorescence spectroscopy | Monitor conformational changes | Probe selection, protein concentration, spectral parameters |
| Surface plasmon resonance | Binding kinetics quantification | Surface chemistry, flow rate, regeneration conditions |
| Microscale thermophoresis | Interaction affinity measurement | Labeling strategy, concentration range, buffer optimization |
Reconstitution strategies:
Develop protocols for reconstitution in model membranes:
Liposomes of varying composition
Nanodiscs with defined lipid composition
Supported lipid bilayers for surface-based assays
Optimize protein:lipid ratios systematically
Validate functional reconstitution through activity assays
Consider co-reconstitution with potential interaction partners
Structural studies of membrane-associated forms:
Comparative analysis provides crucial insights into protein function and evolution. For Mjls_2492:
Systematic comparative analysis framework:
Sequence-based comparative approach:
Perform comprehensive homology searches across mycobacterial genomes
Construct multiple sequence alignments using MUSCLE or MAFFT
Generate phylogenetic trees using maximum likelihood or Bayesian methods
Identify conserved residues and domains across mycobacterial species
Map conservation onto predicted structural models
Structure-based comparative analysis:
Generate structural models of homologs using AlphaFold or similar tools
Perform structural superposition to identify conserved spatial features
Calculate root mean square deviation (RMSD) between structures
Identify structurally conserved regions that may indicate functional sites
Compare electrostatic surface properties across homologs
Functional comparison methodology:
| Aspect | Analysis Approach | Interpretation Framework |
|---|---|---|
| Expression patterns | Compare expression data across species | Identify common regulatory patterns |
| Genomic context | Analyze gene neighborhoods across species | Infer functional associations from conserved operons |
| Interaction networks | Compare known interactors across species | Identify conserved interaction modules |
| Phenotypic effects | Compare knockout phenotypes where available | Determine functional conservation across species |
Evolutionary analysis integration:
Calculate selection pressure (dN/dS) across protein sequences
Identify sites under positive or purifying selection
Correlate evolutionary rates with structural/functional domains
Apply coevolution analysis to identify functionally linked residues
Translational relevance assessment:
Bioinformatic prediction can guide functional characterization of Mjls_2492:
Comprehensive function prediction methodology:
Sequence-based function prediction:
Implement PSI-BLAST and HHpred for remote homology detection
Apply motif scanning using PROSITE, PRINTS, and PFAM databases
Utilize gene ontology prediction tools (InterProScan, PANNZER)
Perform transmembrane topology prediction (TMHMM, Phobius)
Apply signal peptide prediction (SignalP) and subcellular localization tools
Structure-based function prediction:
Generate structural models using AlphaFold or Rosetta
Implement fold recognition through DALI or TM-align
Perform active site prediction using CASTp or POCASA
Apply ligand binding site prediction (FTSite, SiteMap)
Utilize molecular docking to test potential substrates/ligands
Integrated prediction approaches:
| Method | Application | Interpretation Strategy |
|---|---|---|
| Genomic context analysis | Function inference from operonic structure | Identify functionally related gene clusters |
| Protein-protein interaction prediction | Interactome construction | Map potential functional pathways |
| Coevolution analysis | Identification of functionally coupled residues | Guide mutagenesis experiments |
| Integrative scoring systems | Confidence assessment of predictions | Prioritize hypotheses for experimental validation |
Machine learning integration:
Apply supervised learning approaches with known UPF0353 family members
Implement feature extraction from sequence and structural properties
Utilize ensemble methods to improve prediction accuracy
Consider deep learning approaches for complex pattern recognition
Experimental validation design:
Contextualizing Mjls_2492 research within the broader field of mycobacterial biology:
Context integration methodology:
Pathway integration approach:
Map Mjls_2492 function to known mycobacterial metabolic pathways
Integrate with transcriptomic/proteomic datasets from mycobacterial studies
Connect to signaling networks through interaction mapping
Analyze regulation patterns under different environmental conditions
Physiological context framework:
Relate function to mycobacterial cell envelope biology
Connect to stress response mechanisms if applicable
Integrate with persistence/dormancy mechanisms
Evaluate contribution to virulence or host interaction
Evolutionary context analysis:
Determine conservation across mycobacterial species
Identify potential horizontal gene transfer events
Analyze selection pressure in different mycobacterial lineages
Compare with homologs in other actinobacterial genera
Translational significance evaluation:
| Application Area | Integration Approach | Impact Assessment |
|---|---|---|
| Drug discovery | Target validation framework | Essentiality, druggability, resistance potential |
| Diagnostic development | Biomarker potential analysis | Specificity, expression levels, accessibility |
| Vaccine research | Immunogenicity evaluation | Conservation, surface exposure, immune response |
| Synthetic biology | Engineering application assessment | Modularity, orthogonality, functional predictability |
Collaborative research framework:
Avoiding misinterpretation in recombinant protein studies:
Comprehensive interpretation framework:
Expression artifact identification:
Compare properties between native and recombinant proteins:
Post-translational modifications
Subcellular localization
Oligomerization state
Activity levels
Validate key findings in native expression systems
Consider impact of tags on protein function
Evaluate effects of overexpression on observed phenotypes
Experimental design validation:
Implement appropriate controls for each experiment type:
Negative controls (empty vector, inactive mutants)
Positive controls (well-characterized proteins)
Internal controls for normalization
Ensure biological relevance of experimental conditions
Validate key findings using complementary approaches
Consider physiological concentrations in interaction studies
Data interpretation safeguards:
| Potential Pitfall | Prevention Strategy | Validation Approach |
|---|---|---|
| Correlation-causation confusion | Design mechanistic studies | Implement intervention experiments |
| Overlooking alternative explanations | Systematic hypothesis testing | Consider multiple models for observations |
| Confirmation bias | Blinded experimental design | Independent validation by collaborators |
| Statistical overinterpretation | Appropriate statistical methods | Multiple testing correction, effect size analysis |
Replication and validation:
Implement both technical and biological replicates
Verify critical findings with alternative methods
Consider independent validation in different laboratories
Test robustness across different experimental conditions
Transparent reporting:
Future research on Mjls_2492 should focus on systematic characterization and integration with broader mycobacterial biology:
Priority research directions:
Comprehensive functional characterization:
Complete structural determination through X-ray crystallography or cryo-EM
Implement systematic mutagenesis to map functional domains
Develop specific activity assays based on predicted functions
Establish in vivo models to assess physiological relevance
Systems biology integration:
Construct comprehensive interaction networks
Perform multi-omics analysis of knockout/knockdown strains
Map regulatory networks controlling expression
Develop mathematical models of associated biological processes
Comparative biology approaches:
Extend studies to homologs in pathogenic mycobacteria
Implement cross-species complementation studies
Evaluate evolutionary patterns across mycobacterial lineages
Identify species-specific adaptations in protein function
Translational research opportunities:
Assess potential as antimycobacterial drug target
Evaluate immunogenicity for vaccine development
Explore biotechnological applications based on function
Develop diagnostic applications if species-specific features exist
Methodological innovations:
Collaborative research frameworks offer powerful approaches for comprehensive characterization:
Collaborative research strategy:
Consortium-based research model:
Establish multi-laboratory collaborations with complementary expertise:
Structural biology
Biochemistry and enzymology
Microbial genetics
Systems biology
Computational biology
Implement standardized protocols across laboratories
Develop central data repositories for integrated analysis
Coordinate research priorities and resource allocation
Resource sharing framework:
Establish repositories for plasmids, strains, and protein samples
Develop shared computational resources for bioinformatic analysis
Implement common data standards for interoperability
Create protocol repositories with detailed methodologies
Integrated research approaches:
| Collaborative Approach | Implementation Strategy | Expected Outcome |
|---|---|---|
| Parallel characterization | Simultaneous study of homologs across species | Comprehensive functional comparison |
| Functional screening | Distributed high-throughput assay development | Rapid functional hypothesis testing |
| Multi-omics integration | Coordinated datasets across species | Systems-level understanding of protein role |
| Evolutionary analysis | Comprehensive sampling across mycobacterial phylogeny | Evolutionary context of protein function |
Knowledge synthesis framework:
Implement regular collaborative reviews and meta-analyses
Develop integrated databases for UPF0353 family proteins
Create predictive models incorporating multi-species data
Establish consensus nomenclature and functional classification
Training and capacity building: