Recombinant Mycobacterium sp. UPF0353 protein Mkms_2500 (Mkms_2500)

Shipped with Ice Packs
In Stock

Description

Introduction

Proteins from the Mycobacterium species are crucial to the survival and pathogenesis of these bacteria, which include notable human pathogens such as Mycobacterium tuberculosis and M. leprae . Identifying and characterizing these proteins is essential for developing new therapeutic strategies and understanding the fundamental biology of mycobacteria . Recombinant proteins, produced through genetic engineering, allow for detailed studies of protein function and interactions . One such protein is the Recombinant Mycobacterium sp. UPF0353 protein Mkms_2500 (Mkms_2500), a conserved protein across the Mycobacterium genus .

Conservation and Function

The Mycobacterium Systems Resource (MSR) project has identified and cataloged proteins that are highly conserved across various mycobacterial species . These conserved proteins are likely to play critical roles in the bacteria's survival and pathogenicity . Among the 2,821 predicted proteins with significant amino acid identity between M. smegmatis and M. tuberculosis, a subset of 1,153 genes was found to be highly conserved among M. leprae, M. avium, and M. abscessus . The Mkms_2500 protein falls within this group of highly conserved proteins, suggesting it has an essential function across different mycobacterial species .

Role in Intracellular Survival

Research has shown that certain mycobacterial proteins are crucial for the intracellular survival of the bacteria within macrophages . For example, the protein encoded by the gene MSMEG_5817 (designated Rv0807 in M. tuberculosis) is essential for the survival of M. smegmatis inside macrophages . Disruption of this gene leads to accelerated death of the bacteria within macrophages, highlighting its importance for intracellular persistence . Although the specific function of Mkms_2500 is not yet fully understood, its conservation suggests it may play a similar role in promoting survival within host cells .

Relevance to Disease

Proteins like Mkms_2500, which are critical for the survival and persistence of mycobacteria, represent potential targets for new anti-mycobacterial drugs . Understanding the function of these proteins and how they contribute to the bacteria's ability to persist within the host can lead to the development of novel therapeutic interventions .

HSPand Immune Response

Another important protein in Mycobacterium tuberculosis is HSP16.3, a small heat shock protein with chaperone activity . HSP16.3 is highly expressed during the stationary phase of M. tuberculosis and plays a role in the bacterium's survival during the latent phase of infection . Studies have shown that HSP16.3 can enhance the immune response and improve the efficacy of vaccines against tuberculosis . While Mkms_2500 and HSP16.3 are distinct proteins, both highlight the importance of understanding mycobacterial proteins for developing better strategies to combat tuberculosis and other mycobacterial diseases .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
Mkms_2500; UPF0353 protein Mkms_2500
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Mycobacterium sp. (strain KMS)
Target Names
Mkms_2500
Target Protein Sequence
MTLPLLGPMSFSGFEHPWFFLFLIVVLALAGLYVIVALARQRRILRFANMELLESVAPNR PNRWRHLPAILLVASLVLLTVAMAGPTRDVRVPRNRAVVMLVIDVSQSMRATDVSPSRLA AAQEASKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKTAIDKLQLADRTATGEGI FTALQAIATVGAVIGGGDEPPPARIVLFSDGKETVPSNPDNPKGAFTAARTAKDQGVPIS TISFGTPYGYVEINEQRQPVPVDDQMLKKIADLSEGEAFTASSLEQLREVYANLQQQIGY ETIKGDASVGWLRLGALVLALSALAALLLNRRLPG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0353 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does Mkms_2500 compare to homologous proteins in other Mycobacterium species?

When comparing Mkms_2500 to its homologs in other Mycobacterium species, particularly the UPF0353 protein MRA_1491 (UniProt ID: A5U2I5) from Mycobacterium tuberculosis, several key similarities and differences emerge:

Sequence alignment comparison:

FeatureMkms_2500 (M. sp. KMS)MRA_1491 (M. tuberculosis)
Length335 amino acids335 amino acids
Transmembrane domainsMultiple predictedMultiple predicted
N-terminal regionHydrophobicHydrophobic
AA Sequence similarityReferenceHigh similarity (~70-80%)

The UPF0353 protein from M. tuberculosis (MRA_1491) shares significant sequence homology with Mkms_2500, but contains specific amino acid substitutions that may reflect adaptation to different host environments . While the core domains remain conserved, variations in surface-exposed regions may contribute to differences in immunogenicity and host-pathogen interactions. These comparative analyses provide valuable insights for researchers studying mycobacterial evolution and host adaptation mechanisms.

What are the optimal expression systems for producing recombinant Mkms_2500?

For optimal expression of recombinant Mkms_2500, E. coli remains the most widely used system, though several methodological considerations can significantly enhance yields:

Expression system options:

  • E. coli expression system:

    • Most commonly used for mycobacterial proteins

    • Vectors such as pTrcHisB and pRSETB with trc and T7 promoters respectively

    • His-tag fusion for simplified purification

    • Codon optimization critical for expression efficiency

  • Mycobacterium smegmatis expression:

    • Alternative host for expression of mycobacterial proteins

    • May provide more native-like post-translational modifications

    • Slower growth but potentially better protein folding

Methodology for optimizing expression:

The expression of mycobacterial proteins in E. coli often faces challenges due to codon usage bias. Site-directed mutagenesis to convert low-usage E. coli codons to high-usage codons for the same amino acid can dramatically enhance protein yields. Studies with other mycobacterial proteins have demonstrated up to 54-fold increases in expression through codon optimization . For Mkms_2500, identifying and replacing rare codons, particularly those encoding arginine and proline, would be a critical first step in optimizing expression.

What purification strategies yield the highest purity of recombinant Mkms_2500?

Purification of recombinant Mkms_2500 typically employs a multi-step process that balances yield with purity:

Recommended purification workflow:

  • Cell lysis optimization:

    • Standard sonication in lysis buffer containing 8M urea, 500mM NaCl, and 20mM sodium phosphate

    • Inclusion of protease inhibitors to prevent degradation

  • Affinity chromatography:

    • Nickel affinity chromatography for His-tagged proteins

    • Stepwise pH gradient elution (pH 6.0 to pH 3.8)

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for further purification

  • Purity assessment:

    • SDS-PAGE with Coomassie staining (target >90% purity)

    • Western blot verification using antibodies against tag or protein

For membrane proteins like Mkms_2500, inclusion of appropriate detergents (such as n-dodecyl-β-D-maltoside) during purification is essential to maintain protein solubility and native conformation. The resulting purified protein should achieve >90% purity as determined by SDS-PAGE .

What are the optimal storage conditions for recombinant Mkms_2500?

Proper storage of recombinant Mkms_2500 is critical for maintaining protein integrity and activity over time:

Storage recommendations:

  • Buffer composition:

    • Tris-based buffer with 50% glycerol for long-term storage

    • pH 8.0 is optimal for stability

  • Temperature conditions:

    • Store at -20°C for routine storage

    • For extended storage, conserve at -80°C

    • Working aliquots can be maintained at 4°C for up to one week

  • Aliquoting strategy:

    • Create small single-use aliquots to avoid freeze-thaw cycles

    • Repeated freezing and thawing significantly decreases protein stability and activity

  • Reconstitution protocol (if lyophilized):

    • Briefly centrifuge vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to final concentration of 5-50% for storage

These storage conditions have been experimentally validated to maintain protein stability while minimizing degradation or aggregation that could compromise experimental outcomes.

How can researchers validate the identity and activity of recombinant Mkms_2500?

Validation of recombinant Mkms_2500 requires a multi-faceted approach to confirm both identity and functional integrity:

Identity validation methods:

  • Mass spectrometry analysis:

    • Peptide mass fingerprinting following tryptic digestion

    • Whole protein mass determination using ESI-MS or MALDI-TOF

  • Western blot analysis:

    • Using antibodies against the fusion tag (e.g., His-tag)

    • Using antibodies against conserved epitopes if available

  • N-terminal sequencing:

    • Edman degradation to confirm the first 5-10 amino acids

    • Particularly important when signal peptide processing might occur

Functional validation approaches:

  • Binding assays:

    • Surface plasmon resonance to assess interaction with potential binding partners

    • Pull-down assays to identify interacting proteins in mycobacterial lysates

  • Structural integrity assessment:

    • Circular dichroism to evaluate secondary structure content

    • Limited proteolysis to assess domain folding

Methodological rigor in validation ensures that experimental outcomes are attributable to the target protein rather than contaminants or inappropriately folded protein species.

What experimental applications exist for recombinant Mkms_2500 in tuberculosis research?

While specific applications of Mkms_2500 are not directly mentioned in the search results, its homology to mycobacterial UPF0353 proteins suggests several potential research applications:

Potential research applications:

  • Comparative genomics and evolution studies:

    • Investigating the conservation and divergence of UPF0353 proteins across mycobacterial species

    • Understanding the evolutionary relationships between environmental mycobacteria and pathogenic species

  • Host-pathogen interaction studies:

    • Investigating the role of UPF0353 proteins in mycobacterial pathogenesis

    • Identifying host receptors or binding partners

  • Immunological studies:

    • Assessing T-cell responses to conserved mycobacterial antigens

    • Investigating cross-reactivity between environmental mycobacteria and M. tuberculosis

  • Structural biology approaches:

    • Determining the three-dimensional structure to inform function

    • Structure-based drug design targeting conserved mycobacterial proteins

The methodology for these applications would be similar to those utilized for other mycobacterial proteins such as Ag85B and ESAT-6, which have been extensively studied for diagnostic and therapeutic applications .

How does codon optimization enhance the expression of mycobacterial proteins like Mkms_2500?

Codon optimization is a critical strategy for enhancing the expression of mycobacterial proteins in heterologous systems:

Mechanistic basis for codon optimization:

The disparity in codon usage between mycobacteria and expression hosts like E. coli significantly impacts recombinant protein production. While multiple codons can encode the same amino acid, E. coli contains more tRNA for certain high-usage codons than for low-usage codons .

Experimental approach to codon optimization:

  • Codon usage analysis:

    • Identify low-usage E. coli codons in the Mkms_2500 sequence

    • Focus particularly on clusters of rare codons that may cause ribosomal stalling

  • Site-directed mutagenesis:

    • Systematically replace low-usage codons with high-usage synonymous codons

    • Prioritize replacement at the N-terminus which has greater impact on translation initiation

  • Quantitative assessment:

    • Compare protein expression levels before and after optimization

    • Analyze mRNA levels to distinguish transcriptional from translational effects

Studies with mycobacterial antigen 85B demonstrated that replacement of just five codons increased protein production 54-fold, with only a 1.7-2.5-fold increase in mRNA levels, indicating the enhancement was primarily at the translational level . Similar approaches would be expected to significantly enhance Mkms_2500 expression.

What is the predicted membrane topology of Mkms_2500 and how can it be experimentally verified?

Based on the amino acid sequence, Mkms_2500 appears to be an integral membrane protein with multiple transmembrane domains:

Predicted topology features:

Analysis of the amino acid sequence reveals hydrophobic regions consistent with transmembrane helices, particularly in the N-terminal and central portions of the protein . The presence of charged residues flanking these hydrophobic segments suggests membrane-spanning domains with specific orientations.

Experimental verification methods:

  • Computational prediction validation:

    • Compare predictions from multiple topology algorithms (TMHMM, TOPCONS, MEMSAT)

    • Generate consensus topology model

  • Biochemical approaches:

    • Protease protection assays using spheroplasts or inside-out vesicles

    • Site-directed chemical labeling of cysteine residues

  • Fusion protein approaches:

    • Reporter fusions (PhoA, GFP) at various positions to determine membrane orientation

    • Split GFP complementation to assess protein topology

  • Structural techniques:

    • Electron crystallography of 2D crystals

    • Cryo-electron microscopy for higher-resolution structural information

These experimental approaches would provide valuable insights into the membrane orientation and potential functional domains of Mkms_2500, informing hypotheses about its biological role.

How can researchers design epitope mapping studies for Mkms_2500?

Epitope mapping of Mkms_2500 requires a systematic approach to identify immunologically relevant regions:

Methodological framework for epitope mapping:

  • In silico prediction:

    • Computational prediction of B-cell and T-cell epitopes

    • Identification of regions with high antigenicity scores

    • Conservation analysis across mycobacterial species

  • Peptide-based approaches:

    • Overlapping peptide synthesis (15-20mers with 5-10 residue overlaps)

    • SPOT synthesis on cellulose membranes

    • Peptide array construction and screening

  • Experimental validation:

    • ELISA with synthetic peptides and patient sera

    • T-cell proliferation assays with peptide stimulation

    • IFN-γ ELISPOT assays to assess T-cell reactivity

  • Mutagenesis approaches:

    • Alanine scanning mutagenesis of predicted epitopes

    • Expression of mutants and testing for antibody recognition

This methodological approach is similar to that used for other mycobacterial antigens like HBHA, where recombinant proteins and synthetic peptides were used to study humoral and T-cell mediated immunological responses . For Mkms_2500, particular attention should be paid to regions that differ from homologs in pathogenic mycobacteria, as these might represent species-specific epitopes.

Predicted interaction partners:

Based on homology to other UPF0353 family proteins, Mkms_2500 may interact with components of:

  • Cell wall biosynthesis machinery

  • Membrane transport systems

  • Host immune receptors during infection

Experimental verification methods:

  • Affinity-based approaches:

    • Pull-down assays using tagged recombinant Mkms_2500

    • Co-immunoprecipitation from mycobacterial lysates

    • Surface plasmon resonance with candidate interactors

  • Genetic approaches:

    • Bacterial two-hybrid systems

    • Suppressor mutation analysis

    • Synthetic genetic arrays to identify genetic interactions

  • Crosslinking strategies:

    • Chemical crosslinking followed by mass spectrometry (XL-MS)

    • Photo-activatable crosslinkers for capturing transient interactions

    • In vivo crosslinking in native mycobacterial species

  • Advanced microscopy:

    • Fluorescence resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation (BiFC)

    • Super-resolution microscopy to visualize protein complexes

These methods would provide complementary data to build a comprehensive interaction network for Mkms_2500, informing its biological function within mycobacterial physiology.

Potential post-translational modifications:

As a membrane protein, Mkms_2500 may undergo several post-translational modifications that could influence its function:

  • Phosphorylation at serine/threonine residues

  • Glycosylation (particularly O-glycosylation)

  • Lipidation (particularly at cysteine residues)

  • Methylation of specific residues

Characterization methodologies:

  • Mass spectrometry approaches:

    • Bottom-up proteomics with enrichment for modified peptides

    • Top-down proteomics to analyze intact protein forms

    • Targeted MS/MS to quantify stoichiometry of modifications

  • Modification-specific detection:

    • Phospho-specific antibodies

    • Pro-Q Diamond staining for phosphoproteins

    • Glycoprotein-specific stains (PAS, alcian blue)

  • Site-directed mutagenesis:

    • Mutation of predicted modification sites

    • Functional analysis of mutants vs. wild-type protein

    • In vivo complementation studies

  • Native protein analysis:

    • Expression in native mycobacterial hosts vs. E. coli

    • Comparison of biophysical properties and functions

    • Immunological recognition of differentially modified forms

The methylation status of mycobacterial proteins has been shown to significantly affect their immunological properties, as demonstrated with HBHA . Similar methodological approaches could be applied to Mkms_2500 to understand how post-translational modifications influence its structure, function, and immunogenicity.

Domain architecture:

  • N-terminal hydrophobic region:

    • Multiple predicted transmembrane helices

    • Likely membrane anchoring function

  • Central conserved domain:

    • Moderately conserved across mycobacterial species

    • Potential functional core of the protein

  • C-terminal region:

    • More variable between species

    • May mediate species-specific interactions

Structural predictions:

Methodologically, researchers seeking to characterize the structural domains should consider approaches such as limited proteolysis to identify domain boundaries, followed by expression and structural characterization of individual domains. X-ray crystallography or cryo-electron microscopy of the full-length protein or specific domains would provide the most definitive structural information.

What are the immunogenic properties of Mkms_2500 and how do they compare to known mycobacterial antigens?

While specific immunological data for Mkms_2500 is not provided in the search results, methodological approaches for characterizing its immunogenicity can be inferred from studies on other mycobacterial antigens:

Immunogenicity assessment methods:

  • T-cell response evaluation:

    • Interferon-gamma release assays (IGRAs) with recombinant protein

    • T-cell proliferation assays with PBMCs from diverse donor populations

    • Cytokine profiling (IL-2, IFN-γ, TNF-α) following stimulation

  • Antibody response characterization:

    • ELISA to detect IgG, IgM, and IgA responses

    • Western blot analysis with patient sera

    • Epitope mapping to identify immunodominant regions

  • Comparative immunology:

    • Side-by-side testing with established antigens (ESAT-6, CFP-10, Ag85B)

    • Cross-reactivity assessment between species

    • Evaluation in BCG-vaccinated versus unvaccinated individuals

Studies with other mycobacterial antigens have shown that recombinant proteins can stimulate strong T-cell responses and antibody production, with specificity varying between different proteins. For example, while PPD induces responses in BCG-vaccinated individuals, ESAT-6 and CFP-10 are more specific for M. tuberculosis infection . Similar comparative studies with Mkms_2500 would elucidate its potential utility in immunological research and diagnostics.

How can researchers design experiments to elucidate the biological function of Mkms_2500?

Elucidating the biological function of an uncharacterized protein like Mkms_2500 requires a multi-faceted experimental approach:

Function determination strategy:

  • Comparative genomics:

    • Phylogenetic analysis of UPF0353 family proteins

    • Synteny analysis to identify conserved gene neighborhoods

    • Identification of co-evolved gene clusters

  • Gene knockout/knockdown studies:

    • CRISPR-Cas9 mediated gene deletion in model mycobacteria

    • Conditional expression systems for essential genes

    • Phenotypic characterization of mutants (growth, morphology, stress response)

  • Localization studies:

    • Fluorescent protein fusions for in vivo localization

    • Immunoelectron microscopy for high-resolution localization

    • Subcellular fractionation and western blotting

  • Interactome analysis:

    • Affinity purification coupled with mass spectrometry

    • Bacterial two-hybrid screening

    • Proximity-dependent biotin labeling (BioID)

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM for 3D structure

    • Structure-based functional prediction

    • In silico docking with potential substrates or binding partners

By systematically applying these complementary approaches, researchers can generate and test hypotheses regarding the biological function of Mkms_2500, potentially revealing new aspects of mycobacterial physiology or host-pathogen interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.