Recombinant Mycobacterium sp. UPF0353 protein Mmcs_2455 (Mmcs_2455)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Proteins are shipped on blue ice unless dry ice is specifically requested. Please contact us in advance for dry ice shipping; additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and storing in aliquots at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.

Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mmcs_2455; UPF0353 protein Mmcs_2455
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Mycobacterium sp. (strain MCS)
Target Names
Mmcs_2455
Target Protein Sequence
MTLPLLGPMSFSGFEHPWFFLFLIVVLALAGLYVIVALARQRRILRFANMELLESVAPNR PNRWRHLPAILLVASLVLLTVAMAGPTRDVRVPRNRAVVMLVIDVSQSMRATDVSPSRLA AAQEASKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKTAIDKLQLADRTATGEGI FTALQAIATVGAVIGGGDEPPPARIVLFSDGKETVPSNPDNPKGAFTAARTAKDQGVPIS TISFGTPYGYVEINEQRQPVPVDDQMLKKIADLSEGEAFTASSLEQLREVYANLQQQIGY ETIKGDASVGWLRLGALVLALSALAALLLNRRLPG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0353 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How are Mycobacterium species detected and identified in research settings?

Detection and identification of Mycobacterium species, including those expressing Mmcs_2455, employ a multi-method approach:

  • PCR-based detection: PCR assays at the genus level using the Cobas Amplicor platform provide high sensitivity (100% for smear-positive and 47.9% for smear-negative specimens) with 97.7% specificity .

  • Specimen preparation: Clinical specimens require decontamination using sodium hydroxide method (for samples from sterile sites) or N-acetyl-l-cysteine-sodium hydroxide method (for respiratory samples) .

  • Microscopic examination: Auramine-rhodamine fluorochrome staining followed by confirmation with Ziehl-Neelsen staining serves as the initial identification step .

  • Culture methods: Standard media (7H11 plates and BBL MGIT) incubated for 7 weeks at 37°C for mycobacterial recovery .

  • Molecular identification: 16S rRNA gene sequence analysis provides definitive species identification. For positive genus assay samples, PCR-mediated sequencing using primers like KY18 and KY75 or 283 and 264 is performed, followed by sequence analysis using specialized software .

This multi-step approach ensures accurate detection and differentiation of Mycobacterium species in research samples.

What are the optimal storage conditions for recombinant Mmcs_2455 protein?

Maintaining protein stability is crucial for experimental reproducibility. For recombinant Mmcs_2455 protein:

  • Long-term storage: Store at -20°C/-80°C upon receipt, with aliquoting recommended for multiple use .

  • Buffer composition: Tris/PBS-based buffer with 6% Trehalose at pH 8.0 provides optimal stability .

  • Reconstitution protocol:

    • Centrifuge vial briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration (50% is standard)

    • Prepare small working aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots: Can be stored at 4°C for up to one week .

  • Stability concerns: Repeated freezing and thawing significantly reduces protein activity and should be avoided .

Following these storage protocols ensures maximum protein stability and experimental consistency when working with Mmcs_2455.

How can I design optimal experiments for Mmcs_2455 protein functional studies?

Effective experimental design for Mmcs_2455 protein studies should follow structured approaches to maximize statistical power and minimize confounding variables:

  • Statistical power planning: Perform sample size analysis to estimate appropriate replicate numbers for different effect sizes. This prevents underpowered studies that might miss significant effects .

  • Technical confounders arrangement: Systematically evaluate and manage technical confounding factors such as operator variability, equipment differences, and environmental conditions .

  • Repeated measures design: Implement sampling from the same experimental units repeatedly, which increases scalability and robustness while accounting for variability between experimental units .

  • Mixed-model analysis pipeline: Incorporate confounding factors into a mixed-model analysis to increase statistical power, enabling detection of effects at earlier timepoints and lower treatment doses .

  • Flow cytometry validation: For cellular studies, validate multicolor flow cytometry setups to accurately determine cell type, maturity, and viability metrics when studying protein effects .

This structured approach to experimental design significantly improves reproducibility and robustness of findings in Mmcs_2455 protein research, particularly for complex biological systems.

What techniques are most effective for extracting and amplifying Mycobacterium DNA for Mmcs_2455 studies?

Optimized DNA extraction and amplification protocols for Mycobacterium species include:

  • DNA extraction protocol:

    • Use 0.5 mL of decontaminated sample

    • Process with respiratory specimen preparation kit (e.g., Roche Diagnostics)

    • Follow manufacturer instructions for the Cobas Amplicor system

  • PCR amplification strategies:

    • Primary amplification: Use pan-Mycobacterium primers KY18 and KY75 or primers 283 and 264 in separate PCR reactions

    • Reamplification (if needed): Use primers KY18 and 259 or primers 283 and 259

    • Sequencing: Use primer Mbakt-14 for optimal results

  • Validation metrics:

    • Consider a specimen positive if optical density (OD₆₆₀) ≥0.5 and at least 2-fold higher than negative control

    • Confirm negative results by ensuring OD₆₆₀ <0.5 and internal control OD₆₆₀ ≥0.35

    • For NTM identification, verify that genus assay OD₆₆₀ ≥0.50 and M. tuberculosis assay is negative (OD₆₆₀ <0.35)

  • Sequence analysis workflow:

    • Analyze sequences using specialized software (e.g., SmartGene IDNS)

    • For complex identification (e.g., M. chelonae complex), perform additional gene analysis (rpoB, hsp65)

These techniques provide highly specific and sensitive detection of Mycobacterium species, essential for studying Mmcs_2455 in various research contexts.

How should I handle missing data in Mmcs_2455 research studies?

Missing data in Mmcs_2455 research can lead to biased estimates and incorrect inferences. Implement these modern approaches to maintain data integrity:

  • Maximum likelihood estimation: This approach uses all available information from observed data to estimate parameters that would have been obtained with complete data .

  • Bayesian estimation: Incorporates prior information with observed data to provide posterior distributions of parameters, offering flexibility for complex missing data patterns .

  • Multiple imputation: Creates multiple complete datasets by replacing missing values with plausible estimates, analyzing each dataset separately, and pooling results following specific combining rules .

Missing Data ApproachAdvantagesBest Application Scenarios
Maximum Likelihood- No imputed datasets needed
- Handles MCAR and MAR patterns
- Efficient with large datasets
- Structural equation modeling
- Longitudinal studies with dropout
Bayesian Estimation- Incorporates prior information
- Provides full posterior distributions
- Handles small samples
- Complex missing data patterns
- When prior information is available
Multiple Imputation- Separates imputation from analysis
- Works with any analysis method
- Incorporates imputation uncertainty
- Mixed methods studies
- When multiple analyses are planned

These approaches significantly improve the reliability and validity of findings compared to traditional methods like listwise deletion or mean imputation, which can introduce substantial bias in Mmcs_2455 research .

How can protein structure analysis inform functional studies of Mmcs_2455?

Advanced structural analysis of Mmcs_2455 provides critical insights into its functional mechanisms:

  • Sequence-structure relationships: The 335-amino acid sequence of Mmcs_2455 contains distinctive regions that suggest membrane association. The presence of hydrophobic segments, particularly in the N-terminal region (MTLPLLGPMSFSGFEHPWFFLFL), indicates potential transmembrane domains .

  • Structural motif identification: Analysis of the amino acid sequence reveals multiple transmembrane alpha-helical regions (LIVVLALAGLYVIVALAR), suggesting Mmcs_2455 may function as a membrane protein involved in cellular transport or signaling .

  • Functional domain analysis: The C-terminal region contains sequences consistent with potential binding sites (STISFGTPYGYVEINEQRQPVPVD), which may indicate interaction with other cellular components or substrates .

  • Structure-guided mutagenesis approaches: Based on sequence analysis, researchers should consider targeted mutations in the following regions:

    • Residues 67-88 (PAILLVASLVLLTVAMAGPTR): potential functional domain

    • Residues 245-265 (LKKIADLSEGEAFTASSLEQL): possible regulatory region

Advanced structural biology techniques such as X-ray crystallography, cryo-EM, or NMR spectroscopy would provide definitive structural information to complement these sequence-based predictions and guide more targeted functional studies.

What are the challenges in distinguishing between Mycobacterium species when studying Mmcs_2455 expression?

Species differentiation presents significant challenges that researchers must address:

  • Sequence homology complexities: UPF0353 proteins have varying degrees of homology across Mycobacterium species, requiring careful primer design and sequence analysis. For example, PCR-based detection showed 69% of positive samples with OD₆₆₀ values ≥2.0 were correctly identified, while samples with OD₆₆₀ <2.0 required additional verification .

  • Multi-gene verification approach: Researchers should implement a hierarchical gene analysis strategy:

    • Primary identification: 16S rRNA gene sequencing

    • Secondary verification: For M. chelonae complex, rpoB sequencing

    • Tertiary confirmation: For M. kansasii/gastri, hsp65 sequence analysis

  • Specificity limitations: Even established assays like Cobas Amplicor M. tuberculosis show limited specificity, highlighting the need for multiple confirmation methods when working with mycobacterial proteins .

  • Analytical validation matrix:

Identification MethodSensitivity for Smear-PositiveSensitivity for Smear-NegativeSpecificityKey Limitation
Genus-level PCR100%47.9%97.7%Limited species differentiation
Species-specific PCRVaries by speciesLower than genus PCR>98%Requires prior knowledge of species
16S rRNA Sequencing~95%~90%>99%Slow turnaround time
Combined molecular approach>99%~85%>99%Complex workflow

These challenges underscore the importance of employing multiple complementary approaches when studying Mmcs_2455 expression across different Mycobacterium species .

How can microphysiological systems (MPS) be applied to study Mmcs_2455 protein function?

Microphysiological systems (organ-on-a-chip) offer advanced platforms for studying protein function in near-physiological environments:

  • Optimized experimental design: When applying MPS to Mmcs_2455 studies, researchers should:

    • Identify and test confounding factors systematically

    • Arrange technical confounders (chip operator, control unit) to maximize robustness

    • Implement repeated measures sampling from chips to improve scalability

    • Incorporate these factors into mixed-model analysis pipelines

  • Cell type verification: Validate multicolor flow cytometry setups to accurately determine cell types and maturation states when studying Mmcs_2455 effects on different cell populations .

  • Sample size determination: Perform power analysis to estimate appropriate replicate numbers for detecting different effect sizes:

Effect SizeRecommended ReplicatesPower at α=0.05Confidence Level
Large (d≥0.8)4-6>80%95%
Medium (d≈0.5)7-10>80%95%
Small (d≈0.2)>20>80%95%
  • Integration advantages: MPS platforms allow researchers to:

    • Study Mmcs_2455 in complex tissue contexts

    • Evaluate lineage-specific effects of protein expression

    • Detect subtle phenotypic changes with greater sensitivity

    • Explore protein function under dynamic conditions

These systems represent the cutting edge of functional protein research, offering unprecedented insights into protein behavior in complex biological environments that more closely mimic in vivo conditions.

What statistical approaches are most appropriate for analyzing Mmcs_2455 functional data?

  • Mixed-model analysis: This approach accounts for both fixed and random effects, making it ideal for complex experimental designs with multiple potential confounding variables. For Mmcs_2455 studies, this allows researchers to incorporate experimental factors like batch effects, operator variability, and measurement time points .

  • Handling missing data: Apply modern missing data techniques including:

    • Maximum likelihood estimation for structural models

    • Multiple imputation for complex datasets

    • Bayesian approaches when prior information is available

  • Power analysis framework: To ensure sufficient statistical power:

    • Calculate minimum sample sizes needed for detecting expected effect sizes

    • Account for potential data loss in experimental planning

    • Consider increasing sample size by 10-15% to maintain power despite potential missing data

  • Data transformation considerations: For non-normally distributed measurements commonly encountered in protein expression studies:

    • Log transformation for right-skewed data

    • Box-Cox transformation for improving normality

    • Non-parametric approaches when transformations are insufficient

These statistical approaches maximize the information extracted from experimental data while maintaining appropriate control of Type I and Type II errors, essential for robust Mmcs_2455 functional analysis.

How can I effectively integrate multiple data types when studying Mmcs_2455?

Modern Mmcs_2455 research generates diverse data types requiring integrated analysis approaches:

  • Multi-omics integration strategy:

    • Combine protein expression, localization, and interaction data

    • Correlate with gene expression patterns across conditions

    • Integrate metabolomic changes associated with protein function

    • Develop unified computational frameworks to handle heterogeneous data types

  • Structural-functional correlation:

    • Map sequence variations to functional domains

    • Correlate structural predictions with experimental observations

    • Use sequence alignment with homologous proteins to identify conserved regions

  • Temporal data integration: For time-course experiments:

    • Implement time-series analysis methods

    • Account for different sampling frequencies across data types

    • Apply dynamic modeling approaches to capture system evolution

  • Visual data integration approaches:

    • Use dimensionality reduction techniques (PCA, t-SNE)

    • Implement network visualization for protein interaction data

    • Develop custom visualization tools for complex data relationships

These integrated approaches provide a more comprehensive understanding of Mmcs_2455 function than single-method studies, revealing emergent properties that might not be apparent in isolated datasets.

What are the common pitfalls in data interpretation for Mmcs_2455 research?

Researchers should be aware of several critical pitfalls when interpreting Mmcs_2455 data:

Awareness of these pitfalls allows researchers to implement appropriate controls and analytical approaches, leading to more reliable and reproducible findings in Mmcs_2455 research.

What emerging technologies show promise for advancing Mmcs_2455 research?

Several cutting-edge technologies are poised to transform Mmcs_2455 research:

  • Advanced microphysiological systems (MPS): Organ-on-chip technologies that recapitulate 3D microenvironments offer unprecedented opportunities to study protein function in near-physiological contexts. These systems improve clinical predictivity and allow for complex multifactorial experiments .

  • CRISPR-based functional genomics: Precise genome editing enables:

    • Targeted modification of Mmcs_2455 expression levels

    • Introduction of specific mutations to probe structure-function relationships

    • Creation of reporter systems for real-time monitoring

    • High-throughput screening of functional interactions

  • Single-cell technologies: Advanced techniques like:

    • Single-cell RNA-seq to examine cellular responses to Mmcs_2455

    • Single-cell proteomics to analyze protein interactions

    • Spatial transcriptomics to map expression patterns in tissue contexts

  • AI and machine learning applications:

    • Prediction of protein-protein interactions

    • Analysis of complex datasets from multi-omics approaches

    • Development of predictive models for protein function

    • Automated image analysis for localization studies

These emerging technologies promise to overcome current limitations in Mmcs_2455 research, enabling more comprehensive understanding of protein function in complex biological systems.

How might Mmcs_2455 research contribute to broader understanding of Mycobacterium biology?

Mmcs_2455 research has potential to advance several key areas in mycobacterial biology:

  • Membrane biology insights: As a potential membrane protein, Mmcs_2455 studies could reveal crucial information about:

    • Mycobacterial membrane organization and dynamics

    • Transport mechanisms specific to this bacterial genus

    • Stress response pathways related to membrane integrity

  • Evolutionary perspectives: Comparative analysis of UPF0353 proteins across species can illuminate:

    • Evolutionary relationships within the Mycobacterium genus

    • Functional adaptations in different ecological niches

    • Conservation of essential protein domains across bacterial phyla

  • Diagnostic applications: Improved understanding of Mmcs_2455 may enhance detection methods:

    • Development of more specific PCR-based assays

    • Creation of antibody-based detection systems

    • Identification of unique peptide signatures for mass spectrometry

  • Physiological function elucidation: Determining the precise role of Mmcs_2455 could reveal:

    • Previously unknown metabolic pathways in mycobacteria

    • Novel cellular processes specific to this bacterial genus

    • Potential vulnerability points for therapeutic intervention

These broader contributions highlight the importance of fundamental research on proteins like Mmcs_2455 for advancing our understanding of bacterial biology beyond immediate practical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.