Recombinant Mycobacterium tuberculosis ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; MRA_1314; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Target Names
atpF
Target Protein Sequence
MGEVSAIVLAASQAAEEGGESSNFLIPNGTFFVVLAIFLVVLAVIGTFVVPPILKVLRER DAMVAKTLADNKKSDEQFAAAQADYDEAMTEARVQASSLRDNARADGRKVIEDARVRAEQ QVASTLQTAHEQLKRERDAVELDLRAHVGTMSATLASRILGVDLTASAATR
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 catalytic core (extramembraneous) and the F0 membrane proton channel. These are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and part of the peripheral stalk, linking F1 to F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structural role of subunit b (atpF) in Mycobacterium tuberculosis ATP synthase?

Subunit b (atpF) serves as a critical component of the peripheral stalk or "stator" in the F-ATP synthase complex of Mycobacterium tuberculosis (Mtb). Similar to what has been established in other prokaryotic systems, the b subunit likely connects the peripheral F₁ catalytic domain to the membrane-embedded F₀ portion, preventing rotation of the F₁ sector during ATP synthesis . The b subunit in bacterial ATP synthases typically forms a dimer, mediating structural stability that is essential for the proper functioning of the entire ATP synthase complex . While much of our understanding comes from E. coli models, the Mtb b subunit likely shares fundamental structural properties while possessing unique mycobacterial characteristics that could be exploited for targeted drug development.

How does the atpF gene in Mycobacterium tuberculosis differ from other mycobacterial species?

The Mtb ATP synthase shows significant differences from other mycobacterial species, such as the non-pathogenic Mycobacterium smegmatis (Msm). These differences are particularly relevant for drug targeting studies . While the search results don't specifically detail atpF variations, genome sequence analysis has revealed that compared to Msm ATP synthase, the Mtb ATP synthase exhibits structural and functional differences that affect drug targeting effectiveness . These differences highlight why heterologous expression systems are valuable for studying Mtb proteins without the associated biohazard risks. Research suggests that proper understanding of Mtb-specific ATP synthase components, including atpF, is critical for developing targeted anti-tuberculosis therapies.

What is the significance of studying recombinant Mtb atpF in tuberculosis research?

Studying recombinant Mtb atpF is significant because ATP synthase in Mtb is a validated drug target, as evidenced by the effectiveness of bedaquiline, which primarily targets the c subunit of ATP synthase . The b subunit (atpF), as part of the stator structure, plays an essential role in maintaining proper ATP synthase function. Understanding its structure and function could reveal new druggable sites. Recombinant production of atpF enables safer handling compared to working with virulent Mtb strains, and allows for detailed structural studies, protein-protein interaction analyses, and drug screening without biosafety level 3 containment requirements . This approach supports the development of novel TB therapeutics targeting different components of the ATP synthase complex.

What expression systems are most effective for producing recombinant Mtb atpF protein?

For producing recombinant Mtb atpF, a heterologous expression system using Mycobacterium smegmatis has proven particularly effective. This approach involves transferring the Mtb ATP synthase gene cluster with an affinity purification tag into M. smegmatis competent cells, while knocking out the native Msm ATP synthase genes to avoid hybrid complex formation . Specific protocols include:

  • Inserting the Mtb ATP synthase gene cluster into the sodC gene locus of Msm using streptomycin as a selection marker

  • Knocking out the Msm ATP synthase genome using hygromycin as a selection marker

  • Eliminating the auxiliary gene knockout plasmid through repeated subculture

  • Transferring a prokaryotic expression vector containing the Mtb ATP synthase gene cluster

This method resolves the technical challenge of heterologous expression of essential multi-subunit protein complexes and prevents the formation of hybrid complexes that could complicate structural and functional analyses .

What purification strategies yield the highest purity and structural integrity of recombinant atpF?

An optimal purification strategy for recombinant Mtb atpF includes:

  • Culture of the recombinant M. smegmatis strain at 37°C with shaking

  • Induction of expression using acetamide after cooling cultures to 16°C

  • Cell disruption of collected bacterial cells

  • Purification of the membrane total protein solution using affinity chromatography via the engineered tag

This approach leverages the affinity purification tag incorporated into the expression construct and maintains the structural integrity of the protein by using controlled induction conditions. The lower temperature (16°C) during induction likely helps reduce protein aggregation and improper folding. While the specific details for atpF purification aren't explicitly provided in the search results, these general principles from the heterologous expression of Mtb ATP synthase components provide a foundation for developing atpF-specific protocols.

How can researchers effectively monitor the dimerization of recombinant atpF in experimental systems?

Based on ATP synthase b subunit studies in other prokaryotic systems, researchers can monitor atpF dimerization using several complementary approaches:

  • Analytical ultracentrifugation to determine the oligomerization state and assess the frictional ratio, which indicates the elongated nature of properly formed dimers (a correctly formed b subunit dimer would show a frictional ratio around 1.60)

  • Solution small-angle X-ray scattering (SAXS) to characterize structural parameters such as:

    • Maximum dimension (approximately 95 Å for properly formed dimers)

    • Radius of gyration (approximately 27 Å)

  • Structural analysis to confirm alpha-helical coiled-coil formation characteristic of functional b subunit dimers

  • Mutation analysis of conserved residues that may influence dimer stability, followed by biophysical characterization to assess the impact on dimerization

These techniques provide complementary data on whether recombinant atpF is forming the expected dimeric structures necessary for proper stator function.

How do structural differences in Mtb atpF contribute to potential drug targeting strategies?

Mtb ATP synthase contains several unique structural features that distinguish it from human ATP synthase and other bacterial homologs, making it an attractive drug target. While the search results don't specifically detail unique features of atpF (subunit b), they do highlight several unique characteristics of other Mtb ATP synthase subunits that suggest similar uniqueness may exist in atpF .

Potential drug targeting strategies based on structural uniqueness could include:

  • Targeting mycobacteria-specific interfaces between atpF and other subunits, particularly if atpF contains unique sequences that mediate these interactions

  • Developing compounds that disrupt the dimerization of atpF, which is essential for proper stator function, if Mtb-specific dimerization interfaces are identified

  • Exploiting potential Mtb-specific post-translational modifications of atpF (similar to the PUP site found at residue K489 in another subunit)

  • Investigating whether atpF in Mtb contains unique extensions or domains similar to the C-terminal domain found in subunit α (amino acids 521-540) that suppresses ATP hydrolysis

Drug design approaches should focus on these mycobacteria-specific features to minimize off-target effects on human ATP synthase.

What role does atpF play in bedaquiline resistance mechanisms in Mycobacterium tuberculosis?

Current evidence suggests that bedaquiline (BDQ) primarily targets the c subunit of ATP synthase, with resistance mechanisms primarily involving mutations in atpE (encoding the c subunit) and Rv0678 (encoding a transcriptional repressor of an efflux pump system) . While specific atpF-related resistance mechanisms aren't described in the search results, as a component of the ATP synthase complex, atpF could potentially influence BDQ efficacy through:

Understanding the complete spectrum of mutations across all ATP synthase components, including atpF, in clinical BDQ-resistant isolates would provide valuable insights into potential secondary resistance mechanisms.

How do post-translational modifications affect the function of Mtb atpF?

While the search results don't specifically address post-translational modifications (PTMs) of atpF, they do highlight that other Mtb ATP synthase subunits undergo important PTMs. For example, subunit α contains a prokaryotic ubiquitin-like protein (PUP) site at residue K489 that could anchor proteasomal degradation . By analogy, atpF may undergo similar mycobacteria-specific modifications that affect:

  • Protein stability and turnover

  • Protein-protein interactions within the ATP synthase complex

  • Regulatory functions related to ATP synthesis/hydrolysis balance

Research approaches to investigate atpF PTMs could include:

  • Mass spectrometry analysis of recombinant and native atpF to identify modification sites

  • Mutagenesis of potential modification sites followed by functional assays

  • Comparative analyses between Mtb and other mycobacterial species to identify Mtb-specific modifications

Understanding these modifications could reveal regulatory mechanisms unique to Mtb and potential targets for therapeutic intervention.

What mutagenesis strategies are most effective for studying atpF function in Mycobacterium tuberculosis?

Based on mutagenesis approaches used for other ATP synthase components, effective strategies for studying atpF function include:

  • Homologous recombineering, which has been successfully used to introduce defined mutations into the Mtb H37Rv reference strain . This approach allows for precise genetic modifications without leaving behind antibiotic resistance markers.

  • Homologous recombination, another approach demonstrated effective for Mtb mutagenesis . When studying essential genes like atpF, this would likely require complementation with a wild-type copy before attempting knockout or mutation of the native gene.

  • Site-directed mutagenesis targeting:

    • Residues predicted to be involved in dimerization

    • Interface regions that interact with other ATP synthase subunits

    • Conserved motifs identified through sequence alignment with other mycobacterial species

  • Construction of chimeric proteins where segments of Mtb atpF are replaced with corresponding segments from other mycobacterial species to identify regions responsible for Mtb-specific functions

The choice between these strategies depends on the specific research question, with homologous recombineering offering the most precise approach for studying the effects of clinically relevant mutations.

What biochemical assays can accurately measure the function of recombinant atpF in the context of the ATP synthase complex?

Assessing recombinant atpF function requires considering its role within the entire ATP synthase complex. Effective biochemical assays include:

  • ATP synthesis activity measurements using inverted membrane vesicles (IMVs) prepared from recombinant strains expressing Mtb ATP synthase with wild-type or mutant atpF

  • ATP hydrolysis activity assays to determine if atpF mutations affect the latent ATP hydrolysis characteristic of mycobacterial ATP synthase, which is crucial for maintaining membrane potential

  • Proton translocation assays using fluorescent probes to monitor proton pumping across membranes, assessing if atpF mutations affect the coupling between ATP hydrolysis and proton translocation

  • Protein-protein interaction studies using techniques such as crosslinking, co-immunoprecipitation, or bacterial two-hybrid systems to examine how mutations in atpF affect its interactions with other ATP synthase subunits

  • Drug susceptibility assays to determine if atpF mutations alter sensitivity to ATP synthase inhibitors like bedaquiline, measured through minimal inhibitory concentration (MIC) determinations

These functional assays should be complemented with structural studies to correlate functional changes with structural alterations.

How can researchers effectively use computational approaches to predict atpF structure and interactions?

Computational approaches provide valuable insights into atpF structure and interactions:

These computational approaches should be validated through experimental studies to confirm predictions and refine models.

How should researchers interpret discrepancies between in vitro studies of recombinant atpF and in vivo observations in Mtb?

When facing discrepancies between in vitro studies using recombinant atpF and in vivo observations in Mtb, researchers should consider:

  • Expression system differences: Recombinant proteins may lack proper post-translational modifications or folding that occurs in native Mtb. The sophisticated expression system described in search result attempts to address this by expressing the entire ATP synthase complex from Mtb in a mycobacterial host, but may still not perfectly recapitulate the native environment.

  • Protein-protein interaction context: AtpF functions as part of a complex multi-subunit assembly. In vitro studies may not capture all relevant interactions, particularly those that are transient or dependent on specific cellular conditions.

  • Environmental factors: The intracellular environment of Mtb during infection differs substantially from standard laboratory conditions. ATP synthase regulation may respond to:

    • Changes in pH

    • Nutrient limitation

    • Oxidative stress

    • Host immune factors

  • Temporal dynamics: Some discrepancies may reflect differences in experimental timeframes versus the slower growth and adaptation cycles of Mtb in vivo.

To address these discrepancies, researchers should employ complementary approaches including genetic studies in Mtb (where feasible), studies in macrophage infection models, and careful validation of recombinant systems to ensure they accurately represent native protein behavior.

What are the most common technical challenges when working with recombinant Mtb atpF and how can they be overcome?

Common technical challenges with recombinant Mtb atpF include:

  • Expression difficulties

    • Challenge: Low expression levels or insoluble protein

    • Solution: Use mycobacterial expression hosts like M. smegmatis , optimize induction conditions (temperature, inducer concentration), express as part of the complete ATP synthase operon rather than in isolation

  • Proper dimerization

    • Challenge: Failure to form stable, functional dimers

    • Solution: Ensure expression of complete domains required for dimerization (similar to residues 62-122 studied in E. coli b subunit) , validate dimer formation using analytical ultracentrifugation or SAXS

  • Stability issues

    • Challenge: Protein degradation during purification

    • Solution: Include protease inhibitors, perform purification at lower temperatures, optimize buffer conditions based on stability assays

  • Functional assessment

    • Challenge: Difficulty measuring atpF function in isolation

    • Solution: Express and purify as part of the complete ATP synthase complex , use complementation assays where mutant atpF is introduced into strains lacking functional atpF

  • Artifactual interactions

    • Challenge: Non-native interactions when overexpressed

    • Solution: Validate interactions using multiple approaches, include appropriate controls, compare with predicted interactions based on structural models

The approach described in search result addresses many of these challenges by expressing the entire ATP synthase complex from Mtb in M. smegmatis after knocking out the native ATP synthase genes, thereby providing a more appropriate context for atpF function.

How do different experimental conditions affect the structural integrity and functional properties of recombinant atpF?

Experimental conditions significantly impact recombinant atpF integrity and function:

ConditionEffect on atpFOptimization Strategy
TemperatureHigher temperatures may destabilize dimers and accelerate degradationExpress at lower temperatures (16°C for induction) ; maintain cold chain during purification
pHExtreme pH can disrupt salt bridges important for dimer stabilityMaintain pH in the range of 6.5-8.0; buffer screening to identify optimal pH
Ionic strengthLow ionic strength may destabilize inter-helical interactions; very high salt can disrupt electrostatic interactionsOptimize salt concentration; typically 100-300 mM NaCl works well for helical proteins
DetergentsNecessary for membrane-associated regions but can disrupt native interactionsUse mild detergents (DDM, LMNG); detergent screening to identify minimal effective concentration
Reducing agentsMay affect any disulfide bonds that stabilize structureInclude reducing agents like DTT or β-mercaptoethanol when appropriate
Expression durationLonger expression times may increase yield but can lead to degradation or aggregationOptimize induction time; monitor expression over time to determine optimal harvest point
Purification methodsHarsh elution conditions can denature proteinUse gentle elution conditions; gradient elution rather than step elution

When studying atpF as part of the ATP synthase complex, additional considerations include maintaining the integrity of the entire complex during purification and ensuring that buffer conditions support native-like interactions between subunits. The acetamide-inducible expression system at 16°C described for Mtb ATP synthase represents optimized conditions that likely preserve structural integrity while allowing sufficient protein production .

What are the most promising approaches for developing atpF-targeted antimycobacterial compounds?

Developing atpF-targeted antimycobacterial compounds represents an underexplored opportunity in TB drug discovery. Promising approaches include:

  • Structure-based drug design targeting:

    • The dimerization interface of atpF, which could disrupt essential structural elements of the ATP synthase complex

    • Interaction surfaces between atpF and other ATP synthase subunits

    • Any Mtb-specific structural features identified through comparative analysis with human ATP synthase components

  • Fragment-based drug discovery using:

    • Biophysical techniques like NMR or thermal shift assays to identify small molecule fragments that bind to atpF

    • Fragment growing or linking strategies to develop high-affinity compounds

    • Computational approaches to identify druggable pockets

  • Combination approaches with existing ATP synthase inhibitors:

    • Compounds that synergize with bedaquiline by targeting different parts of the ATP synthase complex

    • Molecules that might reverse or prevent resistance to bedaquiline through binding to secondary sites

  • Peptide-based inhibitors designed to:

    • Mimic key interaction regions of atpF

    • Disrupt protein-protein interactions essential for ATP synthase function

These approaches would benefit from the recombinant expression system described in search result , which provides a platform for functional screening of candidate compounds against Mtb ATP synthase.

How might the study of atpF contribute to understanding ATP synthase adaptation during latent TB infection?

AtpF may play a crucial role in ATP synthase adaptation during latent TB infection through several mechanisms:

  • Energy homeostasis regulation: Mtb must maintain ATP levels during latency despite reduced nutrient availability. The subunit α of Mtb ATP synthase contains a unique C-terminal domain that suppresses ATP hydrolysis activity, contributing to ATP/ADP homeostasis . AtpF may similarly contain Mtb-specific features that help regulate ATP synthase activity during latency.

  • Structural stability under stress: During latency, Mtb faces various stresses including hypoxia, nutrient deprivation, and acidic pH. AtpF's role in maintaining the structural integrity of ATP synthase may be particularly important under these conditions.

  • Interaction with other cellular systems: AtpF may interact with other proteins involved in dormancy regulation. The potential for PTMs (similar to those seen in other ATP synthase subunits) suggests mechanisms for integrating ATP synthase function with broader cellular responses during latency.

  • Drug tolerance mechanisms: Latent Mtb shows increased tolerance to many antibiotics. Understanding how atpF contributes to ATP synthase function during latency could reveal why some ATP synthase inhibitors remain effective against dormant bacteria while others do not.

Research approaches should include studying atpF expression, modification, and function under in vitro dormancy models that mimic conditions of latent infection.

What insights might comparative analysis of atpF across mycobacterial species provide for tuberculosis research?

Comparative analysis of atpF across mycobacterial species would offer valuable insights:

  • Evolutionary conservation patterns:

    • Identification of highly conserved regions likely essential for core functions

    • Mtb-specific sequences that might contribute to pathogenesis or survival in human hosts

    • Adaptive changes in pathogenic versus non-pathogenic mycobacteria

  • Structural-functional relationships:

    • Correlation between sequence divergence and functional differences in ATP synthase efficiency

    • Identification of regions under positive selection that might reflect host adaptation

    • Prediction of functional importance based on conservation patterns

  • Drug targeting opportunities:

    • Identification of Mtb-specific features that could be exploited for selective drug design

    • Understanding of natural sequence variation that might predict potential resistance mutations

    • Regions uniquely conserved among pathogenic mycobacteria that might serve as broad-spectrum targets

  • Experimental model validation:

    • Assessment of how well M. smegmatis can serve as a model for Mtb ATP synthase studies

    • Identification of which aspects of atpF structure and function can be reliably studied in non-pathogenic models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.