Recombinant Mycobacterium tuberculosis CDP-diacylglycerol pyrophosphatase (cdh)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
cdh; MRA_2306; CDP-diacylglycerol pyrophosphatase; CDP-diacylglycerol phosphatidylhydrolase; CDP-diglyceride hydrolase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Target Names
cdh
Target Protein Sequence
MPKSRRAVSLSVLIGAVIAALAGALIAVTVPARPNRPEADREALWKIVHDRCEFGYRRTG AYAPCTFVDEQSGTALYKADFDPYQFLLIPLARITGIEDPALRESAGRNYLYDAWAARFL VTARLNNSLPESDVVLTINPKNARTQDQLHIHISCSSPTTSAALRNVDTSEYVGWKQLPI DLGGRRFQGLAVDTKAFESRNLFRDIYLKVTADGKKMENASIAVANVAQDQFLLLLAEGT EDQPVAAETLQDHDCSITKS
Uniprot No.

Target Background

Database Links
Protein Families
Cdh family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is CDP-diacylglycerol and its role in Mycobacterium tuberculosis metabolism?

CDP-diacylglycerol (CDP-DAG) serves as a critical intermediate in the synthesis of essential phospholipids in Mycobacterium tuberculosis. It functions as a key precursor for the biosynthesis of phosphatidylinositol (PI) and cardiolipin (CL), which play specialized roles in mycobacterial cell physiology. While PI can be phosphorylated to create derivatives involved in signal transduction and membrane trafficking, cardiolipin is primarily important for maintaining mitochondrial function in eukaryotes but also has significant roles in bacterial membrane integrity .

In mycobacteria, CDP-DAG is synthesized from phosphatidic acid (PA) and CTP through the action of CDP-DAG synthase (CDS) enzymes. This reaction represents a rate-limiting step in phospholipid biosynthesis pathways critical for bacterial survival. The proper functioning of these pathways is essential for maintaining membrane structure and function in M. tuberculosis .

How do pyrophosphatase activities influence metabolic pathways in M. tuberculosis?

Pyrophosphatase activities are crucial for driving metabolic reactions to completion in M. tuberculosis. These enzymes catalyze the hydrolysis of pyrophosphate (PPi) to orthophosphate (Pi), which is a highly exergonic reaction. By removing pyrophosphate, a common byproduct in many biosynthetic reactions, pyrophosphatases drive thermodynamically unfavorable reactions forward .

In M. tuberculosis metabolism, pyrophosphatase activity is particularly important in:

  • Nucleotide-dependent biosynthetic reactions where NTPs are converted to NMP with the release of PPi

  • Isoprenoid biosynthesis pathways, where removal of pyrophosphate drives reactions forward

  • Lipid biosynthesis pathways essential for mycobacterial cell wall development

For instance, in the methylerythritol phosphate (MEP) pathway, IspD catalyzes the transfer of the CMP moiety from CTP to MEP, producing CDP-ME with the release of pyrophosphate. The subsequent removal of this pyrophosphate by pyrophosphatases ensures the reaction proceeds efficiently .

What is the methylerythritol phosphate (MEP) pathway and why is it important in M. tuberculosis research?

The methylerythritol phosphate (MEP) pathway is utilized by M. tuberculosis for the biosynthesis of isopentenyl diphosphate and its isomer, dimethylallyl diphosphate, which are essential precursors for all isoprenoid compounds. This pathway is of particular interest in tuberculosis research for several reasons:

  • It is absent in humans, making it an attractive target for antimycobacterial drug development

  • Disruption of the genes involved in this pathway has shown lethal phenotypes in model organisms like Escherichia coli

  • Isoprenoid compounds produced through this pathway have diverse, essential roles in M. tuberculosis physiology

In M. tuberculosis, isoprenoids play crucial roles in cell wall synthesis and electron transport. For example, polyprenyl phosphate acts as a carrier of activated sugar in the biosynthesis of arabinogalactan, arabinomannan, and lipoarabinomannan, which are essential components of the mycobacterial cell wall. Additionally, the side chain of menaquinone, the only lipoquinone in the electron transport chain in M. tuberculosis, is derived from polyprenyl diphosphate .

What are the biochemical properties of M. tuberculosis IspD and how do they compare to homologous enzymes?

M. tuberculosis IspD (Rv3582c) is a 4-diphosphocytidyl-2-C-methyl-d-erythritol synthase that catalyzes the formation of 4-diphosphocytidyl-2-C-methyl-d-erythritol from MEP and CTP. The purified enzyme has been extensively characterized with the following biochemical properties:

ParameterValue for M. tuberculosis IspDNotes
pH optimum8.0Active over pH range 6.0-9.0
Divalent cation requirement20 mM Mg²⁺ (optimal)Absolutely dependent on divalent cations
Km for MEP58.5 μMReflects moderate substrate affinity
Km for CTP53.2 μMSimilar affinity as for MEP
kcat for MEP0.72 min⁻¹Catalytic turnover rate
kcat/Km for MEP12.3 mM⁻¹min⁻¹Catalytic efficiency
kcat for CTP1.0 min⁻¹Slightly higher than for MEP
kcat/Km for CTP18.8 mM⁻¹min⁻¹Higher catalytic efficiency than for MEP
Nucleotide specificityStrict CTP specificityOther nucleotide 5'-triphosphates do not support activity

The enzyme shows strict specificity for CTP as a substrate, and its activity is absolutely dependent on divalent cations, with magnesium being optimal at a concentration of 20 mM. The kinetic parameters indicate moderate substrate affinity and catalytic efficiency, which is typical for enzymes in secondary metabolic pathways .

How can rational enzyme engineering be applied to modify substrate specificity in related enzymes?

Rational enzyme engineering can be applied to modify substrate specificity through a systematic approach combining structural analysis, molecular dynamics simulations, and targeted mutagenesis. While this hasn't been specifically reported for M. tuberculosis CDP-diacylglycerol metabolizing enzymes, the approach can be adapted from similar studies on other enzymes.

For example, in the case of cyclohexanone dehydrogenase (CDH) from Alicycliphilus denitrificans, researchers successfully enhanced substrate scope through the following methodology:

  • Structural determination: Obtaining a high-resolution X-ray crystal structure of the enzyme in complex with its native substrate to identify key active site residues

  • Molecular dynamics (MD) simulations: Performing MD simulations to understand protein dynamics and substrate interactions

  • Identification of target residues: Analyzing the hydrophobic pocket consisting of key residues that interact with the substrate

  • Rational mutagenesis: Designing variants with altered pocket sizes or hydrophobicity to accommodate bulkier substrates

  • Validation: Testing the engineered variants with various substrates to confirm modified specificity

  • Mechanistic understanding: Using MD simulations of successful variants to understand how mutations create additional space in the active site for accommodating different substrates

In the CDH study, the W113A variant showed enhanced ability to accept bulkier substrates compared to the wild-type enzyme. MD simulations revealed that this substitution created additional space in the active site that could accommodate methyl groups in substituted cyclohexanones and fused aromatic rings .

A similar approach could be applied to M. tuberculosis enzymes involved in CDP-diacylglycerol metabolism to alter their substrate specificity or enhance their catalytic properties.

What are the implications of CDP-diacylglycerol metabolism for developing new anti-TB drugs?

The CDP-diacylglycerol metabolic pathway presents several promising opportunities for anti-TB drug development:

  • Unique bacterial targets: Enzymes involved in CDP-DAG metabolism are either absent in humans or structurally distinct from human homologs, providing selective targeting opportunities with minimal side effects

  • Essential pathways: CDP-DAG is a precursor for phospholipids essential for mycobacterial membrane integrity and function, making these pathways critical for bacterial survival

  • Demonstrated essentiality: Genetic studies have shown that disruption of genes involved in related pathways (such as the MEP pathway) results in lethal phenotypes, confirming their importance for bacterial viability

  • Established druggability: Related enzymes like IspD have been characterized structurally and biochemically, providing crucial information for structure-based drug design

  • Opportunity for synergistic effects: Inhibitors targeting multiple enzymes in phospholipid biosynthesis pathways could provide synergistic effects and reduce the likelihood of resistance development

The MEP pathway, which shares metabolic connections with CDP-DAG metabolism through the utilization of CTP and the generation of pyrophosphate, has already been established as an attractive drug target. Inhibitors of enzymes in this pathway could potentially disrupt multiple aspects of mycobacterial metabolism, including cell wall biosynthesis and energy production .

What are the optimal conditions for expressing and purifying recombinant M. tuberculosis IspD?

Based on successful studies with M. tuberculosis IspD (Rv3582c), the following protocol has proven effective:

Expression system:

  • Host: E. coli (BL21 or similar expression strains)

  • Vector: pET or similar expression vectors with T7 promoter

  • Fusion tags: His₆-tag for affinity purification

  • Induction: IPTG at 0.5-1 mM, when culture reaches OD₆₀₀ of 0.6-0.8

Culture conditions:

  • Media: LB or Terrific Broth supplemented with appropriate antibiotics

  • Temperature: 37°C for growth, reduced to 16-25°C upon induction

  • Duration: 4-6 hours at 37°C or overnight at lower temperatures

Purification protocol:

  • Cell lysis: Sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Clarification: Centrifugation at 20,000 × g for 30 minutes

  • Affinity chromatography: Nickel-NTA or similar resin with imidazole gradient elution

  • Size exclusion chromatography: For further purification and buffer exchange

  • Final storage buffer: 50 mM Tris-HCl pH 8.0, 100 mM NaCl, 10 mM DTT, 1 mM EDTA, and 50% glycerol

Storage conditions:

  • Temperature: -20°C to -80°C

  • Additives: 50% glycerol to prevent freezing damage

  • Aliquoting: Small volumes to avoid freeze-thaw cycles

This protocol typically yields enzyme with sufficient purity and activity for biochemical characterization and inhibitor screening studies .

How can pyrophosphatase activity be measured in recombinant enzymes?

Pyrophosphatase activity can be measured using several complementary approaches:

1. Direct colorimetric assay:

  • Principle: Detection of inorganic phosphate (Pi) released from pyrophosphate hydrolysis

  • Reagents: Malachite green or ammonium molybdate for phosphate detection

  • Procedure: Incubate enzyme with pyrophosphate substrate, stop reaction, add detection reagent, measure absorbance (typically at 620-650 nm)

  • Standard curve: Prepare using known concentrations of inorganic phosphate

  • Controls: Include enzyme-free and substrate-free controls

2. Coupled enzyme assay:

  • Principle: Link pyrophosphate hydrolysis to consumption of NADH via auxiliary enzymes

  • Coupling enzymes: Often uses pyruvate kinase and lactate dehydrogenase

  • Detection: Monitor decrease in NADH absorbance at 340 nm

  • Advantages: Continuous real-time monitoring of activity

3. Radiometric assay:

  • Principle: Use ³²P-labeled pyrophosphate and measure release of labeled phosphate

  • Detection: Thin-layer chromatography or filter-binding assays

  • Advantages: High sensitivity for low activity enzymes

For inorganic pyrophosphatase specifically, a standard reaction typically contains:

  • 100 mM Tris-HCl pH 7.2

  • 2 mM MgCl₂

  • 2 mM pyrophosphate (PPi)

  • Purified enzyme (0.01-0.1 U)

  • Reaction at 25°C for 10 minutes

One unit (U) is defined as the amount of enzyme needed to catalyze the hydrolysis of PPi per minute to produce 1 μmol Pi .

What analytical techniques are most useful for characterizing CDP-diacylglycerol and related metabolites?

Several analytical techniques are particularly valuable for characterizing CDP-diacylglycerol and related metabolites:

1. Liquid Chromatography-Mass Spectrometry (LC-MS/MS):

  • Applications: Quantification and structural characterization of CDP-DAG species

  • Advantages: High sensitivity, specificity, and ability to distinguish different fatty acid compositions

  • Method details: Typically uses reverse-phase chromatography with multiple reaction monitoring

  • Detection limits: Femtomole to picomole range

2. Thin-Layer Chromatography (TLC):

  • Applications: Rapid screening and relative quantification

  • Detection: Phosphomolybdate, iodine vapor, or specific lipid stains

  • Advantages: Simple, cost-effective, requires minimal equipment

  • Limitations: Lower sensitivity and resolution than LC-MS

3. Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • Applications: Structural elucidation and conformational analysis

  • Types: ³¹P NMR particularly useful for phospholipid headgroups

  • Advantages: Non-destructive, provides detailed structural information

  • Limitations: Requires relatively large amounts of purified material

4. Enzyme-Coupled Spectrophotometric Assays:

  • Applications: Measuring enzymatic activities related to CDP-DAG metabolism

  • Detection: Typically monitor absorbance changes at specific wavelengths

  • Advantages: Can be adapted for high-throughput screening

  • Example: For CDS activity, can measure CTP consumption or pyrophosphate release

5. Radiolabeling Studies:

  • Applications: Metabolic flux analysis and pathway elucidation

  • Isotopes: ¹⁴C, ³H, or ³²P-labeled precursors

  • Detection: Scintillation counting, phosphorimaging

  • Advantages: High sensitivity and specificity for tracking metabolic fates

These techniques can be complementary and are often used in combination to provide comprehensive characterization of CDP-diacylglycerol metabolism in mycobacteria .

How should kinetic parameters of recombinant M. tuberculosis enzymes be interpreted?

The interpretation of kinetic parameters for recombinant M. tuberculosis enzymes requires careful consideration of several factors:

1. Catalytic efficiency (kcat/Km):

  • This parameter combines both substrate affinity (Km) and catalytic rate (kcat)

  • For M. tuberculosis IspD, the kcat/Km values are 12.3 mM⁻¹min⁻¹ for MEP and 18.8 mM⁻¹min⁻¹ for CTP

  • These moderate values are typical for secondary metabolic enzymes

  • Comparison with homologous enzymes can provide insight into evolutionary adaptations

2. Substrate affinity (Km):

  • The Km values for M. tuberculosis IspD (58.5 μM for MEP and 53.2 μM for CTP) indicate moderate affinity

  • Interpret in relation to physiological substrate concentrations, which are often not known precisely for M. tuberculosis

  • Higher Km values may suggest that the enzyme does not operate at saturation in vivo

3. Catalytic rate (kcat):

  • The kcat values for M. tuberculosis IspD (0.72 min⁻¹ for MEP and 1.0 min⁻¹ for CTP) are relatively slow

  • This may reflect the slow growth rate of M. tuberculosis compared to other bacteria

  • Can indicate potential rate-limiting steps in metabolic pathways

4. Cofactor dependence:

  • For M. tuberculosis IspD, activity is absolutely dependent on divalent cations, with 20 mM Mg²⁺ being optimal

  • This requirement should be considered when designing inhibitor screening assays

  • Changes in cofactor requirements can indicate altered catalytic mechanisms

5. pH and temperature profiles:

  • M. tuberculosis IspD shows a broad pH optimum (6.0-9.0) with peak activity at pH 8.0

  • This information is valuable for optimizing assay conditions and understanding physiological relevance

  • Temperature optima often reflect the environmental adaptation of the organism

When interpreting these parameters, it's essential to consider the experimental conditions used (buffer composition, temperature, pH) and whether the recombinant enzyme contains modifications (tags, fusion partners) that might affect activity .

What statistical approaches are most appropriate for analyzing enzyme activity data?

Appropriate statistical approaches for analyzing enzyme activity data depend on the experimental design and the specific questions being addressed. The following statistical methods are commonly used:

1. For determining kinetic parameters:

  • Non-linear regression using the Michaelis-Menten equation for standard kinetics

  • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf transformations for visual representation

  • Statistical software packages (GraphPad Prism, SigmaPlot, R) provide built-in models for various enzyme kinetics

2. For comparing enzyme variants or conditions:

  • Analysis of variance (ANOVA) for comparing multiple groups

  • Student's t-test (paired or unpaired) for comparing two groups

  • Multiple comparison corrections (Bonferroni, Tukey, Dunnett) when testing multiple hypotheses

3. For assessing inhibitor potency:

  • IC50 determination through dose-response curves

  • Ki determination through competitive, non-competitive, or mixed inhibition models

  • Hill coefficient calculation for cooperative binding

4. For time-course experiments:

  • Repeated measures ANOVA or mixed-effects models

  • Regression analysis to determine reaction rates

  • Area under the curve (AUC) analysis for cumulative activity measurements

5. For data quality assessment:

  • Z-factor for assessing assay quality in high-throughput screening

  • Coefficient of variation (CV) for evaluating reproducibility

  • Residual analysis for validating model fit

In clinical studies related to Congenital Diaphragmatic Hernia (CDH), researchers have used χ², Fisher exact, nonparametric rank sum and trend tests, and receiver-operator characteristic (ROC) curves to evaluate associations between biomarkers and clinical outcomes. Longitudinal changes in biomarker levels were analyzed using mixed-effects linear models, with transformation of skewed data distributions when necessary .

For all statistical analyses, it's important to:

  • Clearly state the null hypothesis

  • Define significance levels (typically p < 0.05)

  • Report both statistical significance and effect size

  • Consider biological significance alongside statistical significance

  • Use appropriate visualization methods (box plots, scatter plots, bar graphs with error bars)

How should contradictory results in enzyme characterization studies be reconciled?

Contradictory results in enzyme characterization studies are not uncommon and require systematic investigation to reconcile. The following approach can help researchers address such discrepancies:

1. Examine methodological differences:

  • Enzyme source and preparation (expression system, purification method, tags)

  • Assay conditions (buffer composition, pH, temperature, cofactors)

  • Detection methods (direct vs. coupled assays, sensitivity limits)

  • Substrate preparation and purity

2. Consider protein structural factors:

  • Post-translational modifications

  • Oligomerization state

  • Presence of allosteric regulators

  • Conformational heterogeneity

3. Design validation experiments:

  • Reproduce both contradictory results using standardized protocols

  • Systematically vary conditions to identify critical parameters

  • Use orthogonal assay methods to cross-validate findings

  • Test the enzyme under physiologically relevant conditions

4. Apply statistical rigor:

  • Ensure adequate replication (biological and technical)

  • Calculate confidence intervals for key parameters

  • Perform power analysis to ensure sufficient sample size

  • Consider Bayesian approaches to integrate prior information

5. Collaborate to resolve discrepancies:

  • Engage with research groups reporting contradictory results

  • Exchange materials (plasmids, purified proteins) for direct comparison

  • Conduct blinded experiments to minimize bias

  • Consider multi-laboratory validation studies

6. Literature-based reconciliation:

  • Perform meta-analysis of published results

  • Examine trends across multiple studies rather than focusing on outliers

  • Consider species-specific or strain-specific differences

  • Evaluate the quality and reliability of different studies

In some cases, apparent contradictions may reflect genuine biological complexity rather than experimental error. Enzymes may exhibit different properties depending on cellular context, physiological state, or experimental conditions. These differences can provide valuable insights into the regulatory mechanisms and evolutionary adaptations of enzymatic systems in M. tuberculosis .

What emerging technologies could advance our understanding of CDP-diacylglycerol metabolism in M. tuberculosis?

Several emerging technologies hold promise for advancing our understanding of CDP-diacylglycerol metabolism in M. tuberculosis:

1. CRISPR-Cas9 genome editing:

  • Application: Creating precise gene knockouts, knockdowns, or point mutations in mycobacteria

  • Advantage: Allows study of gene function in native context rather than through heterologous expression

  • Challenge: Optimizing efficiency in mycobacteria with complex cell walls

2. Cryo-electron microscopy:

  • Application: Determining high-resolution structures of membrane-associated enzymes

  • Advantage: Enables visualization of enzymes in native-like membrane environments

  • Relevance: Many CDP-DAG metabolizing enzymes are integral membrane proteins that are challenging to crystallize

3. Metabolic flux analysis with stable isotopes:

  • Application: Tracking carbon flow through CDP-DAG pathways

  • Advantage: Provides dynamic information rather than static metabolite levels

  • Methodology: ¹³C-labeled substrates combined with mass spectrometry

4. Single-cell technologies:

  • Application: Examining metabolic heterogeneity in mycobacterial populations

  • Advantage: Reveals cell-to-cell variation that may relate to antibiotic persistence

  • Technologies: Single-cell metabolomics, microfluidics, time-lapse microscopy

5. Proximity labeling proteomics:

  • Application: Identifying protein-protein interactions in CDP-DAG metabolic pathways

  • Methods: BioID, APEX, or TurboID fusions to enzymes of interest

  • Advantage: Works in native cellular environments and can capture transient interactions

6. Advanced computational simulations:

  • Application: Modeling enzyme dynamics and substrate interactions

  • Methods: Molecular dynamics simulations, quantum mechanics/molecular mechanics

  • Example: Similar to those used for cyclohexanone dehydrogenase, where MD simulations revealed how mutations create space for bulkier substrates

7. Lipidomics with ion mobility-mass spectrometry:

  • Application: Comprehensive profiling of mycobacterial lipids with enhanced separation

  • Advantage: Improves isomer separation and structural characterization

  • Relevance: Can detect subtle changes in membrane composition following enzyme inhibition

These technologies, particularly when used in combination, could provide unprecedented insights into the spatial organization, temporal dynamics, and regulatory mechanisms of CDP-diacylglycerol metabolism in M. tuberculosis, potentially revealing new vulnerabilities for therapeutic targeting.

How might drug resistance mechanisms develop against inhibitors targeting CDP-diacylglycerol metabolism?

Understanding potential drug resistance mechanisms is crucial for developing effective and sustainable anti-tuberculosis therapies targeting CDP-diacylglycerol metabolism. Several mechanisms through which M. tuberculosis might develop resistance include:

1. Target-based modifications:

  • Point mutations in enzyme active sites that maintain function but reduce inhibitor binding

  • Overexpression of target enzymes to overcome competitive inhibition

  • Expression of enzyme isoforms with reduced inhibitor affinity

  • Structural rearrangements that alter inhibitor binding pockets

2. Metabolic bypasses:

  • Upregulation of alternative pathways that can produce the same essential end products

  • Acquisition of exogenous lipids from the host to compensate for biosynthetic deficiencies

  • Metabolic rewiring to reduce dependence on CDP-DAG-derived lipids

3. Drug efflux or modification:

  • Increased expression of efflux pumps to reduce intracellular inhibitor concentrations

  • Expression of enzymes capable of chemically modifying or inactivating inhibitors

  • Alterations in cell wall permeability to reduce inhibitor uptake

4. Compensatory mutations:

  • Secondary mutations that restore fitness costs associated with resistance mutations

  • Changes in regulatory networks to adapt to altered lipid metabolism

  • Modifications in cell wall architecture to maintain integrity despite lipid composition changes

5. Stress response adaptations:

  • Enhanced DNA repair mechanisms to address mutations induced by drug pressure

  • Upregulation of chaperones to maintain protein folding under stress conditions

  • Formation of persister cells with altered metabolic states

To address these potential resistance mechanisms, researchers should consider:

  • Targeting multiple steps in CDP-DAG metabolism simultaneously

  • Developing inhibitors that bind to highly conserved regions essential for enzyme function

  • Combining inhibitors of CDP-DAG metabolism with other anti-TB drugs with different mechanisms of action

  • Continuous monitoring of resistance development in clinical isolates

  • Structure-based design of inhibitors with high barriers to resistance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.