Recombinant Mycobacterium tuberculosis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Role in Respiratory Chain

NDH-1 is part of the branched aerobic respiratory chain in M. tuberculosis, contributing to energy production and maintaining redox balance. Key findings:

  • Electron Transfer Mechanism: NDH-1 operates via a nonclassical two-site ping-pong mechanism, where NADH and quinones bind to distinct sites .

  • Redox Plasticity: The enzyme interacts with both oxidized (menaquinone) and reduced (menaquinol) forms, suggesting dual binding sites for quinones .

  • Non-Essential Role: Unlike type II NADH dehydrogenases (NDH-2), NDH-1 is not essential for M. tuberculosis survival under standard conditions but contributes to virulence and persistence .

Research Applications

Recombinant nuoK is primarily used to study mycobacterial respiration and drug targeting:

  • Enzyme Kinetics: Used in assays measuring NADH oxidation rates (absorbance at 340 nm) to characterize inhibitors or substrate preferences .

  • Structural Studies: Facilitates crystallography and mutagenesis to map catalytic domains of the NDH-1 complex .

  • Vaccine Development: Evaluated as a potential antigen in subunit vaccines due to its surface exposure in mycobacteria .

Inhibitor Studies and Therapeutic Potential

NDH-1 is a secondary target for antitubercular drugs, with inhibitors often tested alongside front-line therapies:

  • Phenothiazine Analogs: Inhibit NADH-quinone oxidoreductase activity at IC50 values <10 μM, reducing bacterial respiration .

  • Synergistic Effects: Combining NDH-1 inhibitors with cytochrome bcc-aa3 oxidase inhibitors (e.g., Q203) or ATP synthase blockers (e.g., bedaquiline) enhances bactericidal activity .

Challenges and Future Directions

  • Functional Redundancy: M. tuberculosis compensates for NDH-1 loss via NDH-2, necessitating multi-target inhibition strategies .

  • Structural Flexibility: The enzyme’s conformational dynamics complicate inhibitor design .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; MRA_3188; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Target Names
nuoK
Target Protein Sequence
MNPANYLYLSVLLFTIGASGVLLRRNAIVMFMCVELMLNAVNLAFVTFARMHGHLDAQMI AFFTMVVAACEVVVGLAIIMTIFRTRKSASVDDANLLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this species, the enzyme's immediate electron acceptor is believed to be a menaquinone. The enzyme couples the redox reaction with proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase subunit K (nuoK) in Mycobacterium tuberculosis?

NADH-quinone oxidoreductase (NDH-1) is a multi-subunit complex that plays a crucial role in the electron transport chain of Mycobacterium tuberculosis. The subunit K (nuoK) functions as an integral membrane component of this complex, contributing to energy metabolism and potentially to virulence mechanisms. Similar to the nuoG subunit of the same complex, nuoK may be involved in critical cellular processes related to bacterial survival within host macrophages . Understanding its precise function requires comprehensive biochemical and genetic analyses within the context of the complete NDH-1 complex structure and function.

How does nuoK differ structurally and functionally from other subunits of the NADH-dehydrogenase complex?

The NADH-dehydrogenase complex in M. tuberculosis consists of multiple subunits, each with distinct structural and functional properties. While subunits like nuoG have been demonstrated to play a role in inhibiting host macrophage apoptosis , nuoK has unique properties as a membrane-embedded component. The structural differences can be examined through protein modeling and crystallography studies, while functional differences require genetic manipulation experiments comparing the effects of mutations in different subunits. The table below summarizes the general structural and functional characteristics of various nuo subunits:

SubunitLocation in ComplexPrimary FunctionRole in Virulence
nuoKMembrane-embeddedProton translocationUnder investigation
nuoGPeripheralNADH binding/oxidationInhibition of host apoptosis
Other subunitsVariousElectron transfer, complex assemblyVaried

What expression systems are most effective for producing recombinant M. tuberculosis nuoK?

For structural studies, expression in mycobacterial systems such as M. smegmatis may provide more native-like folding and post-translational modifications. When designing expression studies, researchers should implement the following methodological approach:

  • Optimize codon usage for the selected expression host

  • Consider fusion tags that aid in purification and solubility

  • Test multiple induction conditions (temperature, inducer concentration)

  • Implement specialized solubilization and purification protocols for membrane proteins

  • Verify protein functionality through activity assays post-purification

How should I design experiments to assess the role of nuoK in M. tuberculosis virulence?

To assess the role of nuoK in M. tuberculosis virulence, a systematic experimental approach is essential. Based on research methodologies used for similar virulence factors, the following experimental design is recommended:

  • Generate nuoK deletion mutants (ΔnuoK) using homologous recombination or CRISPR-Cas systems

  • Create complemented strains by reintroducing nuoK into the deletion mutant

  • Perform in vitro infection assays with human or mouse macrophages to assess:

    • Bacterial survival and replication rates

    • Host cell survival and apoptosis rates

    • Cytokine production profiles

  • Conduct in vivo virulence studies in appropriate animal models

Similar studies with nuoG have revealed that deletion of this subunit ablated M. tuberculosis's ability to inhibit macrophage apoptosis and significantly reduced virulence in mice . A comparable approach for nuoK would allow researchers to determine whether this subunit contributes to virulence through similar or distinct mechanisms.

What controls should be included when studying the impact of nuoK mutations on M. tuberculosis phenotypes?

When studying the impact of nuoK mutations on M. tuberculosis phenotypes, implementing appropriate controls is crucial for experimental validity. The experimental design should include:

  • Wild-type M. tuberculosis strain (positive control)

  • ΔnuoK deletion mutant (test strain)

  • Complemented strain (ΔnuoK::nuoK) to verify that observed phenotypes are specifically due to nuoK deletion

  • Controls for selective markers used in genetic manipulation

  • Non-pathogenic mycobacterial species expressing recombinant nuoK to assess gain-of-function effects

These controls help distinguish between effects directly attributable to nuoK versus secondary effects from genetic manipulation. Research on the nuoG subunit demonstrated that expression of M. tuberculosis nuoG in non-pathogenic mycobacteria endowed them with the ability to inhibit apoptosis of infected macrophages . Similar gain-of-function experiments with nuoK would be valuable for determining its specific contribution to bacterial phenotypes.

How should I address contradictory data regarding nuoK function in my research?

When facing contradictory data regarding nuoK function, a systematic approach to data evaluation and experimental refinement is essential. Researchers should:

  • Thoroughly examine all data to identify specific discrepancies between expected and observed results

  • Evaluate the initial assumptions and experimental design:

    • Reassess the hypothesized role of nuoK

    • Review experimental conditions and variables that might influence outcomes

    • Consider strain-specific or context-dependent effects

  • Analyze possible technical issues:

    • Verify reagent quality and experimental protocols

    • Assess data collection methods and instrument calibration

    • Review statistical analyses for appropriateness

  • Consider alternative explanations:

    • Functional redundancy with other nuo subunits

    • Compensatory mechanisms in mutant strains

    • Conditional functionality dependent on environmental factors

When contradictory results emerge, they often lead to novel insights. For example, if nuoK deletion does not show the same virulence attenuation as nuoG deletion, this might indicate distinct functional roles despite being part of the same complex .

What statistical approaches are most appropriate for analyzing nuoK gene expression data across different experimental conditions?

When analyzing nuoK gene expression data across different experimental conditions, selecting appropriate statistical methods is crucial for valid interpretations. Recommended approaches include:

  • For comparing expression levels between two conditions (e.g., wild-type vs. stress condition):

    • Student's t-test (parametric data)

    • Mann-Whitney U test (non-parametric data)

  • For multiple experimental conditions:

    • One-way ANOVA followed by post-hoc tests (Tukey's or Bonferroni) for parametric data

    • Kruskal-Wallis test followed by Dunn's test for non-parametric data

  • For time-course experiments:

    • Repeated measures ANOVA

    • Mixed-effects models to account for both fixed and random effects

  • For correlation with other genes/phenotypes:

    • Pearson or Spearman correlation coefficients

    • Principal component analysis or cluster analysis for pattern identification

The table below summarizes key statistical approaches based on experimental design:

Experimental DesignRecommended Statistical ApproachAssumptions to Verify
Two-group comparisont-test or Mann-WhitneyNormality (for t-test)
Multiple groupsANOVA or Kruskal-WallisHomogeneity of variance (for ANOVA)
Time-courseRepeated measures ANOVASphericity, no missing data points
Gene co-expressionCorrelation analysisLinearity for Pearson correlation

How can I determine if observed phenotypic changes are directly attributable to nuoK rather than secondary effects?

Determining if phenotypic changes are directly attributable to nuoK rather than secondary effects requires a comprehensive experimental approach:

  • Generate multiple mutant types:

    • Clean deletion mutants without antibiotic resistance markers

    • Point mutations affecting specific functional domains

    • Conditional expression mutants

  • Perform complementation studies:

    • Reintroduce wild-type nuoK at different expression levels

    • Introduce nuoK variants with specific mutations

    • Express nuoK under inducible promoters

  • Conduct functional assays:

    • Direct biochemical measurements of NADH-dehydrogenase activity

    • Membrane potential and proton gradient analyses

    • Electron transport chain functionality tests

  • Implement temporal control systems:

    • Inducible gene expression systems

    • Degradation tag-based protein depletion methods

    • Temperature-sensitive mutants (where applicable)

  • Analyze global effects:

    • Transcriptomics to identify differentially expressed genes

    • Metabolomics to assess changes in metabolic pathways

    • Proteomics to evaluate protein-protein interaction networks

This multi-faceted approach helps distinguish between primary effects directly caused by nuoK alteration and secondary adaptations to these changes, similar to approaches used in studies of nuoG function .

What are the most effective approaches for studying protein-protein interactions involving nuoK within the NADH-dehydrogenase complex?

Studying protein-protein interactions involving nuoK within the NADH-dehydrogenase complex requires specialized techniques due to its membrane-embedded nature. Recommended methodologies include:

This combination of techniques provides complementary data to build a comprehensive picture of nuoK's interactions within the complex structure.

How can I apply quantitative and qualitative research methodologies to study nuoK function in different mycobacterial species?

A mixed-methods approach combining quantitative and qualitative methodologies provides comprehensive insights into nuoK function across mycobacterial species:

Quantitative research approaches:

  • Comparative genomics to analyze nuoK sequence conservation across species

  • Growth curve analyses under various conditions (carbon sources, stressors)

  • Enzyme activity assays quantifying NADH oxidation rates

  • Membrane potential measurements using fluorescent probes

  • Survival rate quantification in macrophage infection models

Qualitative research approaches:

  • Structural analyses through protein modeling and crystallography

  • Phenotypic characterization of colony morphology and biofilm formation

  • Microscopy-based assessment of bacterial cell morphology and localization

  • Proteomic analyses of membrane fraction composition

  • Transcriptional profiling to identify co-regulated genes

The integration of both approaches allows researchers to quantify functional parameters while simultaneously developing deeper understanding of biological context and mechanisms. This methodology aligns with the design selection principles outlined in research methodology literature, where the purpose of research dictates the appropriate design selection .

What techniques are available for studying the impact of nuoK on host-pathogen interactions during M. tuberculosis infection?

To study the impact of nuoK on host-pathogen interactions during M. tuberculosis infection, researchers can employ a diverse array of advanced techniques:

  • Cell culture infection models:

    • Primary human macrophages or cell lines infected with wild-type and nuoK mutant strains

    • Multi-parameter flow cytometry to assess macrophage activation and death mechanisms

    • Live-cell imaging to track bacterial replication and host cell responses

    • Co-culture systems incorporating multiple immune cell types

  • Transcriptomic and proteomic approaches:

    • Dual RNA-seq to simultaneously profile host and pathogen gene expression

    • Spatial transcriptomics to map gene expression within granuloma structures

    • Phosphoproteomics to identify signaling pathways affected by nuoK

  • Advanced animal models:

    • Humanized mouse models engrafted with human immune cells

    • Non-human primate models for closer physiological relevance

    • In vivo imaging using reporter strains to track bacterial dissemination

  • Organoid and tissue culture systems:

    • Lung organoids incorporating multiple cell types

    • Artificial granuloma models

    • Microfluidic "organ-on-chip" systems for controlled microenvironments

  • CRISPR screening in host cells:

    • Identify host factors that interact with nuoK-mediated processes

    • Screen for genes affecting bacterial survival in nuoK mutant vs. wild-type infection

These approaches can reveal whether nuoK affects host-pathogen interactions through mechanisms similar to nuoG, which has been shown to inhibit macrophage apoptosis , or through distinct pathways involving energy metabolism or other cellular processes.

How can I optimize expression and purification of recombinant nuoK for structural studies?

Optimizing expression and purification of recombinant nuoK for structural studies requires addressing the challenges associated with membrane proteins:

  • Expression system selection:

    • E. coli strains specialized for membrane proteins (C41/C43, Lemo21)

    • Cell-free expression systems with added lipids or detergents

    • Insect cell or mammalian cell systems for complex proteins

  • Construct design optimization:

    • Test multiple fusion tags (His, MBP, SUMO) at N- and C-termini

    • Incorporate solubility-enhancing domains

    • Create truncated constructs focusing on structured domains

    • Optimize codon usage for expression system

  • Expression condition optimization:

    • Reduced temperature (16-25°C) to slow folding and prevent aggregation

    • Screening of induction parameters (timing, concentration)

    • Addition of specific lipids to expression media

    • Co-expression with chaperones

  • Solubilization and purification optimization:

    • Screen multiple detergents (DDM, LMNG, GDN) for extraction efficiency

    • Implement lipid nanodiscs or SMALPs for native-like environment

    • Use size exclusion chromatography to ensure monodispersity

    • Verify protein folding through circular dichroism or thermal shift assays

The table below summarizes key optimization parameters:

Optimization StageParameters to TestSuccess Indicators
ExpressionTemperature, induction time, media compositionVisible band on Western blot
SolubilizationDetergent type, concentration, timeProtein in soluble fraction
PurificationBuffer composition, pH, salt, additivesPurity >95%, stable in solution
Quality controlThermal stability, activity assaysMonodisperse, functionally active

What are common pitfalls when generating nuoK knockout strains in M. tuberculosis and how can they be addressed?

When generating nuoK knockout strains in M. tuberculosis, researchers commonly encounter several challenges that require specific troubleshooting approaches:

  • Essentiality concerns:

    • If direct knockout attempts fail, implement conditional knockdown systems

    • Use tetracycline-repressible promoters or CRISPRi approaches

    • Verify essentiality through specialized transposon mutagenesis approaches (TnSeq)

  • Polar effects on adjacent genes:

    • Design unmarked deletion strategies to minimize disruption of operon structure

    • Use site-specific recombination systems (FLP/FRT or Cre/loxP)

    • Verify expression of flanking genes in the knockout strain by RT-qPCR

  • Recombination efficiency issues:

    • Optimize homology arm length (typically 500-1000 bp)

    • Consider specialized vectors with temperature-sensitive replicons

    • Enhance transformation efficiency with glycine treatment or other permeabilization methods

  • Compensatory mutations:

    • Sequence the genome of obtained mutants to identify potential suppressor mutations

    • Generate multiple independent mutant strains for phenotypic comparison

    • Implement inducible systems to study acute vs. long-term effects of nuoK deletion

  • Phenotypic verification:

    • Perform thorough biochemical characterization of NDH-1 complex functionality

    • Measure membrane potential and NADH/NAD+ ratios

    • Assess growth in media with different carbon sources

Addressing these challenges systematically increases the likelihood of generating genetically stable and properly characterized nuoK knockout strains similar to the successful generation of nuoG deletion mutants described in the literature .

How should I address unexpected results when studying the effects of nuoK mutations on M. tuberculosis virulence?

When addressing unexpected results in nuoK mutation studies related to M. tuberculosis virulence, implement a comprehensive troubleshooting and analytical approach:

  • Verify the genetic integrity of mutant strains:

    • Confirm deletion/mutation by PCR, sequencing, and Southern blot

    • Check for unintended second-site mutations through whole-genome sequencing

    • Verify expression of neighboring genes to rule out polar effects

  • Reassess experimental conditions:

    • Test multiple infection models (different cell types, animal models)

    • Vary infection parameters (MOI, time points, growth phase of bacteria)

    • Consider environmental conditions that might influence nuoK function

  • Explore alternative hypotheses:

    • Investigate potential functional redundancy with other nuo subunits

    • Consider compensatory mechanisms that might mask nuoK effects

    • Examine condition-specific phenotypes (e.g., under various stress conditions)

  • Implement complementary approaches:

    • Combine genetic approaches with chemical inhibition of NDH-1 complex

    • Study nuoK in the context of related energy metabolism mutants

    • Examine synergistic effects with other virulence factors

When data contradicts the hypothesis, it often leads to new insights about the system under study . For example, if nuoK mutation does not affect virulence in the same way as nuoG mutation, this might suggest specialized functions for different subunits within the same complex and open new avenues of investigation.

What emerging technologies could advance our understanding of nuoK function in M. tuberculosis pathogenesis?

Several emerging technologies hold promise for deepening our understanding of nuoK function in M. tuberculosis pathogenesis:

  • Single-cell technologies:

    • Single-cell RNA-seq to capture heterogeneity in bacterial populations

    • Single-cell proteomics to analyze protein expression at individual cell level

    • Microfluidic platforms for tracking single-cell behaviors over time

  • Advanced structural biology approaches:

    • Cryo-electron tomography of intact bacterial cells

    • Integrative structural biology combining multiple data types

    • Micro-electron diffraction for membrane protein crystals

  • Genome editing advancements:

    • CRISPR-Cas systems optimized for mycobacteria

    • Base editing for precise nucleotide changes

    • Inducible degradation systems for temporal control of protein levels

  • Systems biology approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

    • Flux analysis to quantify metabolic changes due to nuoK alteration

    • Network analysis tools to identify system-wide effects

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize subcellular localization

    • Correlative light and electron microscopy for structural context

    • Live imaging within infected host cells or tissues

These technologies can provide unprecedented insights into how nuoK contributes to M. tuberculosis pathogenesis, potentially revealing mechanisms distinct from those already identified for other subunits like nuoG .

How might comparative studies of nuoK across mycobacterial species inform tuberculosis research?

Comparative studies of nuoK across mycobacterial species can significantly enhance tuberculosis research through several avenues:

  • Evolutionary insights:

    • Sequence conservation analysis to identify functionally critical domains

    • Positive selection analysis to detect regions under evolutionary pressure

    • Reconstruction of ancestral sequences to understand functional evolution

  • Structure-function relationships:

    • Comparison of nuoK structure between pathogenic and non-pathogenic species

    • Identification of pathogen-specific features that could be targeted therapeutically

    • Correlation of structural differences with functional specialization

  • Host-adaptation mechanisms:

    • Analysis of nuoK properties in host-adapted vs. environmental mycobacteria

    • Identification of features conferring advantage in specific host environments

    • Understanding adaptations to different immune pressures

  • Functional conservation and divergence:

    • Complementation studies using nuoK from various species

    • Identification of species-specific interaction partners

    • Characterization of differential regulatory mechanisms

  • Therapeutic targeting opportunities:

    • Identification of M. tuberculosis-specific features as drug targets

    • Understanding conservation to predict resistance development

    • Development of species-selective inhibitors

This comparative approach has proven valuable in studies of other bacterial virulence factors and could reveal whether the virulence functions observed for nuoG are conserved in nuoK across mycobacterial species .

What interdisciplinary approaches could yield novel insights into the relationship between nuoK function and M. tuberculosis virulence?

Interdisciplinary approaches combining multiple scientific fields offer promising avenues for uncovering novel insights into nuoK function and M. tuberculosis virulence:

  • Computational biology and biophysics:

    • Molecular dynamics simulations of nuoK within membrane environments

    • Quantum mechanical modeling of electron transfer processes

    • Network analysis to identify systems-level effects of nuoK perturbation

  • Immunology and cell biology integration:

    • Analysis of nuoK effects on immune signaling pathways

    • Investigation of interactions with host mitochondrial functions

    • Study of nuoK's impact on macrophage metabolism and polarization

  • Chemical biology approaches:

    • Development of chemical probes specific for nuoK

    • Activity-based protein profiling to identify nuoK interaction partners

    • Targeted protein degradation approaches for temporal studies

  • Synthetic biology strategies:

    • Reconstruction of minimal respiratory chains incorporating nuoK

    • Engineering of reporter systems responding to nuoK activity

    • Creation of synthetic regulatory circuits controlling nuoK expression

  • Clinical microbiology connections:

    • Analysis of nuoK sequence variations in clinical isolates

    • Correlation of nuoK polymorphisms with disease progression

    • Investigation of nuoK activity in different disease states

By combining these diverse approaches, researchers can develop a more comprehensive understanding of how nuoK contributes to M. tuberculosis pathogenesis, potentially building upon the established role of nuoG in inhibiting host cell apoptosis to identify additional virulence mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.