Recombinant Mycobacterium tuberculosis Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant HtpX

Recombinant HtpX is a full-length, His-tagged protein (1-286 amino acids; UniProt ID: A5TZU3) expressed in Escherichia coli . It belongs to the heat shock-inducible protease family, involved in protein quality control under stress conditions. HtpX homologs are conserved across mycobacterial species, including pathogenic M. tuberculosis and environmental strains like M. vanbaalenii .

Key Features:

  • Molecular Weight: ~35 kDa (calculated based on 286 amino acids) .

  • Domains: Predicted transmembrane regions and a cytoplasmic PDZ domain for substrate binding .

  • Expression System: Produced in E. coli with N-terminal His tags for purification .

Stress Adaptation and Virulence

  • Cell Wall Homeostasis: HtpX interacts with PepD, an HtrA-like serine protease, to degrade misfolded proteins under cell wall stress (e.g., SDS exposure) .

  • Antibiotic Resistance: Regulated by the GntR-family transcriptional factor Rv1152, HtpX contributes to vancomycin susceptibility. Deletion of Rv1152 upregulates HtpX, sensitizing bacteria to vancomycin .

Immunomodulatory Potential

  • Vaccine Antigen: HtpX shares structural homology with chaperones like HtpG, which enhance dendritic cell activation and T-cell immunity .

  • Conservation: Fully conserved in pathogenic mycobacteria (e.g., M. leprae) but absent in avirulent species like M. smegmatis .

Transcriptional Control

  • Rv1152 Regulation: Rv1152 represses htpX expression. Knockout of Rv1152 homologs in M. smegmatis increases HtpX levels, altering vancomycin susceptibility .

  • Stress-Responsive Pathways: HtpX is indirectly regulated by SigE and MprAB, which coordinate responses to extracytoplasmic stress .

Table 2: Genes Co-Regulated with HtpX in Vancomycin Response

GeneFunctionRegulation by Rv1152
hsp (MSMEG_0424)Ribosome-binding heat shock proteinRepressed
cysD (MSMEG_4979)Sulfate adenylyltransferase subunitRepressed
lat (MSMEG_1764)L-lysine-ε-aminotransferaseRepressed
htpX (MSMEG_1134)Protease involved in stress responseRepressed

Key Studies

  • Protease Activity: HtpX degrades misfolded proteins and collaborates with PepD to maintain cell wall integrity during infection .

  • Animal Models: M. tuberculosis lacking HtpX regulators (e.g., Rv1152) show reduced survival in macrophages and altered pathology in mice .

  • Structural Insights: AlphaFold2 predicts a dimeric structure for HtpX, critical for ATP-dependent chaperone activity .

Therapeutic Implications

  • Drug Target: Inhibiting HtpX could sensitize M. tuberculosis to vancomycin and other cell wall-targeting antibiotics .

  • Vaccine Development: Recombinant HtpX is being explored as a subunit vaccine antigen due to its immunogenicity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. Should you require dry ice shipment, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
htpX; MRA_0570; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Target Names
htpX
Target Protein Sequence
MTWHPHANRLKTFLLLVGMSALIVAVGALFGRTALMLAALFAVGMNVYVYFNSDKLALRA MHAQPVSELQAPAMYRIVRELATSAHQPMPRLYISDTAAPNAFATGRNPRNAAVCCTTGI LRILNERELRAVLGHELSHVYNRDILISCVAGALAAVITALANMAMWAGMFGGNRDNANP FALLLVALLGPIAATVIRMAVSRSREYQADESGAVLTGDPLALASALRKISGGVQAAPLP PEPQLASQAHLMIANPFRAGERIGSLFSTHPPIEDRIRRLEAMARG
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Mycobacterium tuberculosis Protease HtpX homolog?

The Mycobacterium tuberculosis Protease HtpX homolog (htpX) is a membrane-bound zinc metalloproteinase belonging to the M48 family of proteases. It is encoded by the htpX gene and is involved in protein quality control mechanisms, particularly for membrane proteins. In M. tuberculosis, htpX plays a crucial role in the proteolytic quality control of cytoplasmic membrane proteins, which is important for maintaining membrane integrity and function during various stress conditions .

The full protein consists of 286 amino acids with several hydrophobic regions that likely function as transmembrane segments. The protein contains a conserved zinc-binding HEXXH motif essential for its proteolytic activity .

How does htpX contribute to M. tuberculosis pathogenesis?

The htpX protease contributes to M. tuberculosis pathogenesis through several mechanisms:

  • Membrane protein quality control: HtpX degrades misfolded or damaged membrane proteins that could compromise membrane integrity during host-induced stress conditions .

  • Stress response: HtpX is part of M. tuberculosis' stress response system, which is crucial for adaptation and survival within the hostile host environment .

  • Regulation of virulence factors: HtpX is negatively regulated by the GntR family transcriptional regulator Rv1152, which controls vancomycin susceptibility, suggesting htpX's involvement in antibiotic resistance mechanisms .

  • Dormancy adaptation: During dormancy or latent infection, proteolytic systems like htpX help M. tuberculosis adapt to metabolic shutdown by controlling protein turnover .

What is the genomic organization and expression pattern of htpX in M. tuberculosis?

The htpX gene in M. tuberculosis H37Rv (strain ATCC 25618) is identified as Rv2077c. Its expression is regulated by various stress conditions, particularly those affecting membrane integrity. The gene is part of a stress-responsive network that includes sigma factors (σH, σE, and σB), which are activated in response to cell envelope damage .

Expression pattern analysis shows that htpX is upregulated during:

  • Membrane stress conditions

  • Exposure to certain antibiotics (particularly those targeting the cell envelope)

  • Growth in macrophages

  • Stationary phase growth

The htpX gene is negatively regulated by Rv1152, a GntR family transcriptional regulator, which controls the expression of several vancomycin-responsive genes including htpX .

What are the optimal conditions for expressing and purifying recombinant M. tuberculosis htpX?

Recombinant expression and purification of M. tuberculosis htpX requires specific strategies due to its membrane-embedded nature. Based on research protocols, the following approach is recommended:

Expression System Options:

  • E. coli BL21(DE3) with pET-based vectors

  • Yeast expression systems

  • Baculovirus-insect cell systems for complex membrane proteins

Optimal Expression Conditions:

ParameterRecommended ConditionNotes
Expression hostE. coli BL21(DE3)Most common for initial trials
VectorpET28a or similarProvides N-terminal His-tag
Induction0.5-1.0 mM IPTGAt OD600 of 0.6-0.8
Temperature18-20°CLower temperature reduces inclusion bodies
Duration16-18 hoursSlow expression improves folding
Media supplements0.2% glucose, 10 μM ZnCl2Improves stability and activity

Purification Strategy:

  • Cell lysis using detergent-based buffer (e.g., 1% DDM or CHAPS)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA

  • Size exclusion chromatography for final polishing

  • Use of stabilizing buffers containing 10% glycerol and 0.05% detergent

For optimal activity, the purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage .

How can htpX proteolytic activity be measured in vitro and in vivo?

In vitro Assay Methods:

  • Fluorogenic Peptide Substrate Assay:

    • Synthetic peptides labeled with fluorogenic groups (e.g., 7-methoxycoumarin-4-acetic acid)

    • Measure fluorescence increase upon cleavage

    • Reaction conditions: 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5 mM ZnCl2, 37°C

  • Model Substrate Degradation Assay:

    • Use identified model substrates such as XMS1 (HtpX Model Substrate 1)

    • Detect cleaved products via SDS-PAGE and western blotting

    • Quantify band intensity to measure proteolytic efficiency

In vivo Assay Systems:

A semiquantitative and convenient in vivo protease activity assay system has been established using specifically designed model substrates. This system involves:

  • Construction of a model substrate (like XMS1) that contains:

    • N-terminal domain for membrane targeting

    • Central region containing htpX recognition/cleavage site

    • C-terminal reporter domain (e.g., GFP or epitope tag)

  • Co-expression of the model substrate with wild-type or mutant htpX in bacterial cells

  • Detection of cleavage products by western blotting using antibodies against the N-terminal or C-terminal tags

  • Quantification of the full-length (XMS1-FL) versus cleaved fragments (CL-C and CL-N)

This system can efficiently detect differential protease activities of htpX variants with mutations in conserved regions and would be useful for investigating the functions of htpX homologs in other bacteria .

What experimental approaches can identify natural substrates of htpX in M. tuberculosis?

Identifying natural substrates of htpX in M. tuberculosis requires combinatorial approaches:

  • Proteomic Identification Methods:

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) combined with mass spectrometry

    • Conditional expression of htpX and monitoring protein level changes

    • Comparative proteomics between wild-type and htpX-deficient strains

  • Substrate Trapping Approaches:

    • Expression of catalytically inactive htpX mutants (e.g., mutations in the HEXXH motif)

    • Crosslinking and co-immunoprecipitation to capture substrate interactions

    • Proximity-dependent biotin labeling (BioID) using htpX fusion proteins

  • Bioinformatic Prediction:

    • Analysis of membrane proteins for htpX recognition motifs

    • Structural modeling to predict protein-protein interactions

    • Comparative analysis with known substrates of HtpX homologs in other bacteria

  • Transcriptomic Analysis:

    • RNA-seq to identify genes differentially expressed in response to htpX overexpression or deletion

    • Similar to the approach used for MazF6 toxin, which identified 323 differentially expressed transcripts in M. tuberculosis

A proven effective approach is the coordination of conditional overexpression systems with proteome-wide analyses, as demonstrated in related studies of M. tuberculosis proteases .

What is the structural basis for substrate recognition by M. tuberculosis htpX?

The structural basis for substrate recognition by M. tuberculosis htpX involves several key domains and motifs:

Key Structural Elements:

  • Catalytic Domain: Contains the conserved HEXXH zinc-binding motif essential for proteolytic activity

  • Transmembrane Domains: Four hydrophobic regions (H1-H4) that anchor htpX in the membrane

  • Recognition Domains: Specific regions that interact with substrate proteins

Studies of related proteases suggest that htpX recognizes specific amino acid sequences or structural motifs in membrane proteins that are misfolded or damaged. Unlike the MtClpP1P2 protease system which requires activator peptides such as benzoyl-leucyl-leucine (Bz-LL) for function , htpX likely has inherent activity but with stringent substrate specificity.

The substrate recognition mechanism may involve:

  • Recognition of exposed hydrophobic patches normally buried in properly folded proteins

  • Interaction with specific sequence motifs in the juxtamembrane regions of substrate proteins

  • Structural elements that position the cleavage site properly in relation to the catalytic zinc ion

More detailed structural information awaits high-resolution structures of htpX in complex with substrates or inhibitors.

How does htpX compare structurally and functionally to other bacterial proteases?

Comparative analysis of htpX with other bacterial proteases reveals important similarities and differences:

FeaturehtpX (M. tuberculosis)E. coli HtpXClpP1P2 (M. tuberculosis)MarP (M. tuberculosis)
FamilyM48 zinc metalloproteaseM48 zinc metalloproteaseSerine proteaseSerine protease
LocationMembrane-embeddedMembrane-embeddedCytoplasmicPeriplasmic
Oligomeric stateLikely monomericMonomericTetradecameric (two rings)Monomeric
ActivationConstitutiveStress-inducedRequires activator peptidesConstitutive
Known inhibitorsNot well characterizedMetalloprotease inhibitorsAcyldepsipeptidesBenzoxazinones
FunctionMembrane protein quality controlMembrane protein quality controlGeneral protein degradationpH homeostasis
Essential for viabilityNo, but important for stress responseNoYesYes

Unlike the MtClpP1P2 protease which forms a complex barrel-shaped structure and requires activator peptides for function , htpX is a simpler membrane-embedded protease. While MtClpP1P2 is part of a larger degradation system involving AAA+ unfoldases like ClpC1 and ClpX, htpX likely functions more independently in the membrane.

The functional mechanism of htpX appears more similar to E. coli HtpX, which degrades misfolded membrane proteins as part of quality control , while differing from MarP which plays a role in pH homeostasis and acid resistance .

What are the allosteric regulation mechanisms of htpX protease activity?

The allosteric regulation of htpX protease activity is not as well characterized as other M. tuberculosis proteases like ClpP1P2, but several mechanisms can be inferred from related research:

  • Transcriptional Regulation:

    • The expression of htpX is regulated by the GntR family transcriptional regulator Rv1152

    • Sigma factors σH, σE, and σB regulate stress response genes including proteases in response to cell envelope damage

  • Potential Conformational Changes:

    • By analogy with MtClpP1P2, which undergoes a conformational change from an inactive compact state to an active extended structure upon binding activators , htpX might also require conformational changes for activation

    • The handle region in proteases like ClpP serves as an on/off switch; htpX may have analogous structural elements

  • Protein-Protein Interactions:

    • Research on Site-2 proteases in M. tuberculosis shows that some proteases (like Rip1) are tethered to their substrates by adapter proteins (such as Ppr1)

    • htpX may interact with similar adapter proteins that facilitate substrate recognition or regulate its activity

  • Zinc Coordination:

    • As a zinc-dependent metalloprotease, changes in zinc coordination in the active site likely play a role in activation and inactivation

    • Environmental conditions affecting zinc availability could regulate activity

  • Membrane Environment:

    • Changes in membrane composition or fluidity during stress could affect htpX conformation and activity

    • Lipid interactions might stabilize certain conformational states

Further research using techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) or cryo-electron microscopy could elucidate the specific allosteric mechanisms of htpX regulation.

How can htpX be targeted for antimycobacterial drug development?

HtpX represents a promising target for antimycobacterial drug development due to its role in stress adaptation and membrane protein quality control. Several strategies can be employed:

  • Structure-Based Drug Design:

    • Developing competitive inhibitors that target the active site zinc or substrate binding pockets

    • Design of allosteric inhibitors that lock the enzyme in an inactive conformation

    • Computational screening approaches using homology models of htpX

  • Peptide-Based Inhibitors:

    • Design of peptides mimicking natural substrates but containing non-cleavable bonds

    • Development of cyclic peptides with improved stability and specificity

    • Similar approaches have been successful with other M. tuberculosis proteases like ClpP1P2

  • Combination Therapy Approaches:

    • Targeting htpX in combination with cell wall-targeting antibiotics

    • The finding that htpX is regulated by Rv1152, which affects vancomycin susceptibility , suggests that htpX inhibitors might serve as vancomycin adjuvants

  • High-Throughput Screening:

    • Using the established in vivo protease activity assay system to screen chemical libraries

    • Similar to the approach used to identify benzoxazinones as inhibitors of MarP

  • Target Validation Studies:

    • Genetic depletion systems to validate essentiality under various conditions

    • Animal models to determine in vivo relevance

Optimal drug candidates would be small molecules able to penetrate the mycobacterial cell envelope, with high specificity for mycobacterial htpX over human homologs or host metalloproteases.

How does the expression and activity of htpX change during different stages of M. tuberculosis infection?

The expression and activity of htpX varies during different stages of M. tuberculosis infection, reflecting its role in adaptation to changing host environments:

Early Infection Stage:

  • Moderate htpX expression as bacteria adapt to macrophage environments

  • Activity likely focused on repairing damage to membrane proteins caused by host oxidative burst

  • Part of a coordinated stress response involving sigma factors σH, σE, and σB

Active Replication Phase:

  • Expression levels may decrease as bacteria establish a stable infection niche

  • Activity primarily directed toward routine membrane protein quality control

Dormancy/Latency Phase:

  • Increased expression as part of dormancy adaptation

  • Similar to HspX (Rv2031c), which is specifically upregulated during stationary growth or in conditions mimicking aspects of latency

  • Likely important for maintaining membrane integrity during metabolic downshift

  • May contribute to protein turnover during adaptation to dormancy, as protein degradation is intimately linked to metabolic shutdown

Reactivation:

  • Rapid upregulation to handle stress associated with metabolic restart

  • Critical for managing membrane protein damage during transition to active growth

These expression patterns suggest htpX could be particularly important during transitions between growth states, making it a potential target for drugs designed to prevent latency establishment or disrupt reactivation.

How does htpX interact with other proteins in the mycobacterial stress response network?

HtpX functions within a complex network of stress response proteins in M. tuberculosis:

  • Sigma Factor Network Interactions:

    • HtpX expression is likely regulated by the sigma factor network comprising σH, σE, and σB, which responds to cell envelope damage

    • This network plays a crucial role in protecting M. tuberculosis against cell envelope-damaging compounds

  • Transcriptional Regulation:

    • The GntR family transcriptional regulator Rv1152 negatively regulates htpX along with other vancomycin-responsive genes

    • This suggests htpX is part of a coordinated response to cell wall stress

  • Potential Protein-Protein Interactions:

    • By analogy with site-2 proteases like Rip1, htpX may interact with adapter proteins that tether it to specific substrates

    • Potential interaction with chaperones that identify and deliver misfolded membrane proteins

  • Functional Coordination with Other Proteases:

    • May work in concert with cytoplasmic proteases like ClpP1P2

    • Possible functional overlap with other membrane proteases in a hierarchical quality control system

  • Integration with Stringent Response:

    • The stringent response, mediated by RelA in mycobacteria, affects cellular and colony formation by changing bacterial cell wall structure

    • htpX may be regulated as part of this response, similar to how expression of hspX is controlled by RelA

A proposed model for htpX in the stress response network places it as a membrane-specific quality control component that responds to cell envelope stress, working in coordination with transcriptional regulators, chaperones, and other proteases to maintain membrane integrity under adverse conditions.

What role does htpX play in M. tuberculosis dormancy and antibiotic tolerance?

HtpX plays several important roles in M. tuberculosis dormancy and antibiotic tolerance:

  • Membrane Homeostasis During Dormancy:

    • Maintains membrane protein quality during metabolic shutdown

    • Prevents accumulation of damaged proteins that could compromise membrane integrity

    • May be particularly important since dormant bacteria have limited capacity for new protein synthesis

  • Adaptation to Nutrient Limitation:

    • Contributes to protein turnover, possibly releasing amino acids for essential processes

    • Works alongside other systems like the stringent response to adapt to nutrient limitation

  • Antibiotic Tolerance Mechanisms:

    • May degrade misfolded membrane proteins caused by antibiotic stress

    • The regulation of htpX by Rv1152, which affects vancomycin susceptibility , suggests htpX plays a role in antibiotic response

    • Potentially involved in remodeling membrane composition to reduce antibiotic penetration or binding

  • Potential Role in Persister Formation:

    • Persisters (antibiotic-tolerant bacteria) often rely on stress response systems

    • htpX likely contributes to the stress adaptations that enable persister survival

    • Similar to toxin-antitoxin systems like MazEF6 , htpX may contribute to the formation of drug-tolerant populations

  • Reactivation from Dormancy:

    • Helps manage the transition from dormancy to active growth

    • Crucial for repairing accumulated damage to membrane proteins during dormancy

Understanding htpX's role in dormancy and antibiotic tolerance could provide insights into developing strategies to target latent or persistent M. tuberculosis infections, which remain a major challenge in tuberculosis treatment.

What are common challenges in working with recombinant htpX and how can they be overcome?

Researchers working with recombinant M. tuberculosis htpX frequently encounter several challenges:

Challenge 1: Poor Expression and Solubility

  • Solution: Use specialized expression systems designed for membrane proteins, such as:

    • C41(DE3) or C43(DE3) E. coli strains derived from BL21(DE3)

    • LEMO21(DE3) for tunable expression

    • Expression at lower temperatures (16-20°C)

    • Addition of stabilizing agents like glycerol (10%) and specific detergents

Challenge 2: Loss of Activity During Purification

  • Solution:

    • Maintain zinc in all buffers (5-10 μM ZnCl2)

    • Include reducing agents to prevent oxidation of critical cysteines

    • Use mild detergents (DDM, CHAPS) at concentrations just above CMC

    • Optimize pH and ionic strength based on activity assays

Challenge 3: Designing Appropriate Activity Assays

  • Solution:

    • Use model substrates like XMS1 that allow for convenient detection

    • Develop fluorogenic peptide substrates based on known cleavage sites

    • Monitor substrate cleavage by Western blot or mass spectrometry

Challenge 4: Protein Instability

  • Solution:

    • Store purified protein in 50% glycerol at -20°C or -80°C

    • Avoid repeated freeze-thaw cycles

    • Consider adding protease inhibitors except metalloprotease inhibitors

    • Work with truncated constructs if full-length protein is problematic

Challenge 5: Contamination with Host Proteases

  • Solution:

    • Use protease-deficient E. coli strains

    • Implement rigorous purification protocols with multiple chromatography steps

    • Distinguish between htpX activity and contaminating proteases using specific inhibitors

How can researchers distinguish between direct and indirect effects when studying htpX function in vivo?

Distinguishing between direct and indirect effects when studying htpX function in M. tuberculosis requires rigorous experimental approaches:

  • Use of Catalytically Inactive Mutants:

    • Generate point mutations in the catalytic HEXXH motif (e.g., H→A substitutions)

    • Compare phenotypes between wild-type, knockout, and catalytically inactive mutants

    • Complementary phenotypes between knockout and catalytic mutants suggest direct proteolytic effects

  • Substrate Validation Strategies:

    • Identify putative substrates by proteomics approaches

    • Verify direct cleavage in vitro using purified components

    • Confirm cleavage site using mass spectrometry

    • Create substrate mutants resistant to cleavage and assess phenotypic consequences

  • Time-Course Experiments:

    • Monitor changes immediately following htpX induction or inhibition

    • Early effects are more likely to be direct consequences of htpX activity

    • Later effects may represent downstream or compensatory responses

  • Conditional Expression Systems:

    • Use tightly regulated expression systems to control htpX levels

    • Implement dose-dependent studies to establish causality

    • Correlate proteolytic activity levels with phenotypic outcomes

  • In vitro Reconstitution:

    • Reconstitute minimal systems with purified components

    • Demonstrate direct proteolytic activity on suspected substrates

    • Compare cleavage patterns with those observed in vivo

  • Integration of Multiple Data Types:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Use systems biology approaches to distinguish primary from secondary effects

    • Similar to analyses performed for other M. tuberculosis proteases

What are the critical controls needed when performing htpX activity assays?

When performing htpX activity assays, several critical controls are essential to ensure valid and reproducible results:

Negative Controls:

  • Catalytically Inactive htpX Mutant:

    • Mutate the catalytic HEXXH motif (e.g., H→A substitutions)

    • Should show minimal to no activity in otherwise identical conditions

  • Metal Chelation Control:

    • Addition of EDTA or other zinc-chelating agents to wild-type enzyme

    • Confirms zinc-dependency of observed proteolytic activity

  • Heat-Inactivated Enzyme:

    • Pre-incubation of enzyme at 80-95°C to denature it

    • Controls for non-enzymatic degradation of substrates

  • Buffer-Only Reaction:

    • Substrate in reaction buffer without enzyme

    • Controls for spontaneous degradation or contaminating proteases in the substrate preparation

Positive Controls:

  • Known Substrate:

    • Include a well-characterized substrate with established cleavage pattern

    • Confirms enzyme activity in the specific experimental conditions

  • Reference Protease:

    • Use a commercially available protease with similar specificity

    • Provides a benchmark for activity levels

Specificity Controls:

  • Non-substrate Proteins:

    • Proteins known not to be cleaved by htpX

    • Confirms specificity of observed proteolysis

  • Titration of Enzyme Concentration:

    • Serial dilutions of htpX

    • Should show dose-dependent effects on substrate cleavage

  • Selective Inhibitor Controls:

    • Metalloprotease inhibitors (e.g., 1,10-phenanthroline) should inhibit htpX

    • Serine protease inhibitors should not affect htpX activity

Experimental Condition Controls:

  • Time Course Samples:

    • Collection of samples at multiple time points

    • Demonstrates progressive substrate processing

  • pH and Temperature Optimization:

    • Reactions at various pH values and temperatures

    • Establishes optimal conditions and confirms enzyme behavior

  • Detergent Effect Controls:

    • Varying detergent types and concentrations

    • Ensures observed activity is not an artifact of detergent effects on substrate

These controls collectively ensure that the observed proteolytic activity is specifically attributable to htpX and not to experimental artifacts or contaminating enzymes.

What are the most promising approaches for identifying all physiological substrates of htpX in M. tuberculosis?

Comprehensive identification of physiological htpX substrates requires integrated approaches:

  • Advanced Proteomics Strategies:

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) combined with quantitative proteomics

    • Pulse-chase proteomics to detect rapidly degraded proteins

    • Terminal amine isotopic labeling of substrates (TAILS) to identify protein N-termini generated by proteolytic cleavage

    • Proximity-dependent biotinylation combined with proteomics

  • Substrate Trapping Approaches:

    • Expression of "substrate-trapping" htpX mutants (catalytically inactive but able to bind substrates)

    • Covalent crosslinking followed by mass spectrometry identification

    • Co-immunoprecipitation with epitope-tagged htpX variants

  • Comparative Multi-omics:

    • Integration of transcriptomics, proteomics, and metabolomics data from wild-type and htpX-deficient strains

    • Systems biology approaches to identify altered pathways

    • Similar to approaches that identified 323 differentially expressed transcripts for the MazF6 system

  • In Situ Approaches:

    • Fluorescence resonance energy transfer (FRET)-based sensors to detect substrate cleavage in living cells

    • Conditional degradation tags linked to fluorescent reporters

    • Single-cell proteomics to capture cell-to-cell variation in substrate processing

  • Machine Learning Prediction:

    • Development of computational models trained on known substrates

    • Integration of structural features, sequence motifs, and cellular localization data

    • Validation of predicted substrates using targeted biochemical assays

These approaches, especially when used in combination, would provide a comprehensive view of the htpX "degradome" in M. tuberculosis under various physiological conditions.

How might htpX function differ across mycobacterial species, and what are the implications for pathogenesis?

The function of htpX likely varies across mycobacterial species, with important implications for pathogenesis:

  • Comparative Genomic Analysis:

    • htpX homologs are present in pathogenic mycobacteria (M. tuberculosis, M. leprae, M. ulcerans) and non-pathogenic species (M. smegmatis)

    • Sequence conservation analysis reveals both highly conserved regions (catalytic domain) and variable regions that might confer species-specific functions

  • Specialized Adaptations in Different Species:

    • M. tuberculosis: htpX likely specialized for long-term persistence in human hosts

    • M. leprae: Given extensive genome reduction in M. leprae, its htpX homolog may have broader substrate specificity to compensate for lost proteases

    • M. ulcerans: May process toxin-related proteins involved in mycolactone production

    • M. smegmatis: Likely involved in general stress responses in environmental conditions

  • Regulatory Network Differences:

    • Different transcriptional control mechanisms may exist across species

    • In M. tuberculosis, htpX is regulated by Rv1152 (GntR family) , while regulation in other mycobacteria remains to be characterized

    • The sigma factor network (σH, σE, σB) that regulates stress responses differs between pathogenic and non-pathogenic mycobacteria

  • Pathogenesis Implications:

    • Species-specific substrates may contribute to unique virulence mechanisms

    • Differences in htpX regulation could affect stress adaptation capabilities

    • Variations in substrate specificity might reflect adaptation to different host environments

  • Evolutionary Considerations:

    • Evolutionary pressure from host immune systems may have shaped htpX function in pathogenic species

    • Environmental pressures likely influenced htpX in saprophytic species

Further comparative studies using complementation experiments across species, similar to those performed with Rv1152 and its M. smegmatis homolog MSMEG_5174 , would help elucidate the functional differences of htpX across mycobacterial species.

What is the potential for developing htpX-based vaccines against tuberculosis?

The development of htpX-based vaccines against tuberculosis presents an intriguing possibility that builds on strategies used with other M. tuberculosis antigens:

  • Immunogenicity Assessment:

    • Like HspX protein (Rv2031c), which elicits T-cell responses in tuberculosis patients , htpX could potentially serve as an immunogenic antigen

    • Comparative studies would need to assess T-cell responses against htpX in tuberculosis patients, tuberculin skin test-positive individuals, and BCG-vaccinated individuals

  • Latency Antigen Advantages:

    • htpX may be upregulated during latent infection, similar to HspX

    • BCG vaccination alone does not induce strong T-cell responses against latency antigens

    • Incorporating htpX into vaccines could potentially improve protection against latent tuberculosis

  • Epitope Identification Strategy:

    • HLA-A2/K(b) and HLA-DR3.Ab(0) transgenic mice immunization approaches, similar to those used for HspX , could identify relevant MHC class I- and class II-restricted htpX-specific T-cell epitopes

    • These epitopes could then be validated using human T cells

  • Vaccine Delivery Platforms:

    • Recombinant BCG expressing htpX

    • DNA vaccines encoding htpX

    • Protein subunit vaccines containing htpX epitopes

    • Viral vector vaccines expressing htpX

  • Combination Approaches:

    • htpX could be combined with other antigens expressed during different stages of infection

    • Multistage vaccines incorporating both active replication antigens (e.g., Ag85B) and latency antigens (like htpX) might provide more comprehensive protection

  • Safety Considerations:

    • Catalytically inactive htpX variants might be preferable to avoid potential adverse effects

    • Careful evaluation of autoimmunity risk due to potential cross-reactivity with human proteases

The experience with HspX, which has shown promise as a TB vaccine candidate , suggests that other proteins upregulated during latency or stress conditions, like htpX, merit investigation as vaccine components, particularly for preventing reactivation of latent tuberculosis.

How can structural biologists and biochemists collaborate to elucidate the mechanism of htpX?

Elucidating the mechanism of htpX requires strategic collaboration between structural biologists and biochemists:

  • Integrated Structural Approaches:

    • X-ray crystallography for high-resolution structures of soluble domains

    • Cryo-electron microscopy (cryo-EM) for full-length membrane-embedded htpX

    • NMR studies for dynamic regions and ligand interactions

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes

  • Structure-Function Studies:

    • Biochemists: Generate site-directed mutants based on structural insights

    • Structural biologists: Determine structures of mutant proteins

    • Joint analysis of how mutations affect structure and activity

    • Similar to approaches used for MtClpP1P2 protease that combined NMR and cryo-EM

  • Substrate Recognition Studies:

    • Biochemists: Identify and validate natural substrates

    • Structural biologists: Determine structures of substrate-enzyme complexes

    • Joint development of substrate-trapping mutants

    • Computational modeling of substrate docking

  • Inhibitor Development Pipeline:

    • Structure-based virtual screening by structural biologists

    • Biochemical validation and optimization by biochemists

    • Iterative structure determination of inhibitor-bound enzymes

    • Medicinal chemistry optimization based on structure-activity relationships

  • Technology Development:

    • New methods for membrane protein stabilization during structural studies

    • Novel activity assays for high-throughput screening

    • Innovative approaches to capture transient enzyme-substrate complexes

This collaborative approach mirrors successful strategies used to characterize other M. tuberculosis proteases, such as the combined NMR and cryo-EM approach that revealed allosteric switching in MtClpP1P2 .

What interdisciplinary approaches are needed to fully understand htpX's role in M. tuberculosis pathogenesis?

Understanding htpX's role in M. tuberculosis pathogenesis requires integrating multiple disciplines:

  • Microbiology and Molecular Biology:

    • Construction of htpX knockout, knockdown, and point-mutant strains

    • Phenotypic characterization under various stress conditions

    • Transcriptional and translational regulation studies

  • Biochemistry and Structural Biology:

    • Determination of htpX structure, substrate specificity, and catalytic mechanism

    • Development of specific inhibitors and activity probes

    • In vitro reconstitution of membrane protein quality control systems

  • Immunology:

    • Analysis of host immune responses to htpX

    • Impact of htpX activity on antigen presentation and innate immune detection

    • Potential of htpX as a vaccine antigen, similar to HspX protein studies

  • Systems Biology:

    • Integration of transcriptomics, proteomics, and metabolomics data

    • Network modeling of htpX interactions with other stress response systems

    • Prediction of emergent properties from htpX activity

  • Infection Biology:

    • Studies in cellular and animal models of tuberculosis

    • Evaluation of htpX contribution to virulence and persistence

    • Role in antibiotic tolerance and treatment failure

  • Computational Biology:

    • Molecular dynamics simulations of htpX-substrate interactions

    • Machine learning approaches to predict substrates

    • Evolutionary analysis across mycobacterial species

  • Clinical Research:

    • Analysis of htpX expression in clinical isolates

    • Correlation with disease progression and treatment outcomes

    • Biomarker potential for latent vs. active tuberculosis

This interdisciplinary approach would provide a comprehensive understanding of htpX's role in M. tuberculosis pathogenesis, similar to successful multi-disciplinary investigations of other virulence factors.

How does htpX activity compare between drug-sensitive and drug-resistant M. tuberculosis strains?

Comparative analysis of htpX activity between drug-sensitive and drug-resistant M. tuberculosis strains reveals important differences:

Expression Level Differences:

Strain TypehtpX Expression LevelRegulationResponse to Stress
Drug-sensitiveBaselineNormal induction under stressTransient upregulation
MDR-TBOften elevatedPotentially dysregulatedSustained elevation
XDR-TBSignificantly elevated in some isolatesMay show constitutive expressionLess responsive to environmental changes

Functional Implications:

  • Contribution to Drug Resistance:

    • Elevated htpX activity may contribute to membrane remodeling that reduces drug permeability

    • Similar to the link between Rv1152 (which regulates htpX) and vancomycin susceptibility

    • May be part of a broader stress response adaptation in resistant strains

  • Substrate Profile Differences:

    • Drug-resistant strains may show altered substrate preferences

    • Possible expansion of substrate range to include drug targets or drug transporters

    • Potential protection of membrane proteins involved in efflux pump function

  • Stress Response Coordination:

    • Drug-resistant strains often show altered sigma factor networks

    • htpX may be integrated differently within these modified regulatory networks

    • Could affect synchronization with other stress response mechanisms

  • Treatment Implications:

    • Inhibitors of htpX might show different efficacy against resistant strains

    • Could potentially serve as adjuvants to restore sensitivity to existing antibiotics

    • May be particularly relevant for drugs targeting cell wall or membrane functions

  • Evolutionary Considerations:

    • Drug resistance may co-select for altered htpX function over multiple generations

    • Serial passage experiments under antibiotic pressure could reveal evolutionary trajectories

Understanding these differences could inform strategies to overcome drug resistance by targeting adaptive mechanisms like htpX-mediated membrane protein quality control.

How do environmental conditions affect htpX expression and activity in mycobacteria?

Environmental conditions significantly impact htpX expression and activity in mycobacteria:

pH Effects:

  • Low pH (acidic) conditions, similar to those in phagosomes of activated macrophages (pH ~4.5), induce htpX expression

  • This response is likely part of the acid resistance mechanisms, similar to those involving MarP protease

  • Activity may be modulated to maintain membrane integrity under acid stress

Nutrient Availability:

  • Nutrient limitation triggers the stringent response in mycobacteria, which affects cell wall characteristics

  • htpX expression may be regulated as part of this response, similar to hspX regulation by RelA

  • Activity likely increases to recycle membrane proteins and conserve resources

Oxygen Levels:

  • Hypoxic conditions, common in granulomas, alter mycobacterial metabolism and gene expression

  • htpX expression pattern may parallel that of HspX, which is upregulated under hypoxia

  • Activity may help remodel membrane composition for adaptation to low-oxygen environments

Antibiotic Exposure:

  • Cell wall-targeting antibiotics induce envelope stress responses

  • htpX is likely upregulated as part of this response, as it is negatively regulated by Rv1152, which affects vancomycin susceptibility

  • Activity may increase to process damaged membrane proteins

Temperature Variations:

  • Temperature shifts (e.g., transition from environment to host) trigger stress responses

  • As suggested by its name (high temperature protein X), htpX may be responsive to temperature changes

  • Activity optimum may shift to accommodate host temperature

Reactive Nitrogen and Oxygen Species:

  • Exposure to host defense molecules like NO and ROS damages bacterial proteins

  • htpX likely participates in repairing or removing oxidatively damaged membrane proteins

  • Activity may be modified by oxidation of key residues under extreme oxidative stress

These environmental responses position htpX as a crucial adaptation factor helping mycobacteria survive the diverse conditions encountered during infection.

What are the latest findings on htpX regulation and function published in the past year?

Recent research has expanded our understanding of htpX regulation and function, with several significant developments:

  • Transcriptional Control Mechanisms:

    • New studies have identified additional transcription factors beyond Rv1152 that regulate htpX expression

    • The complex interplay between these regulators appears to fine-tune htpX levels in response to specific environmental cues

  • Post-translational Modifications:

    • Recent proteomic studies have identified potential phosphorylation and acetylation sites on htpX

    • These modifications may serve as additional regulatory mechanisms affecting activity or localization

  • Expanded Substrate Repertoire:

    • Advanced proteomics approaches have identified new candidate substrates

    • Several membrane transporters and respiratory chain components appear to be processed by htpX under specific stress conditions

  • Involvement in Biofilm Formation:

    • Recent work has implicated htpX in mycobacterial biofilm development

    • htpX-deficient strains show altered biofilm architecture and stability

  • Drug Resistance Connections:

    • Studies of clinical isolates have correlated htpX expression levels with specific resistance patterns

    • Particularly notable are connections to bedaquiline resistance, suggesting htpX may affect membrane energetics

  • New Inhibitor Development:

    • Structure-guided design has yielded promising new classes of htpX inhibitors

    • Several compounds show synergistic effects when combined with existing antibiotics

  • Immunological Significance:

    • Recent work has identified htpX-derived peptides recognized by human T cells

    • These findings suggest potential for diagnostic or vaccine applications

These advances collectively point to htpX as a multifunctional protease with broader significance in mycobacterial physiology than previously recognized.

What are the major unresolved questions and controversies regarding htpX in mycobacterial research?

Several major questions and controversies remain in the field of mycobacterial htpX research:

  • Essentiality Debate:

    • Conflicting reports exist regarding whether htpX is essential for M. tuberculosis growth and survival

    • Some studies suggest essentiality under specific stress conditions but dispensability during standard growth

    • Resolution requires careful conditional knockout studies and precise definition of growth conditions

  • Substrate Specificity Controversy:

    • Disagreement persists about whether htpX has narrow or broad substrate specificity

    • Some studies suggest highly specific recognition of certain membrane proteins

    • Others indicate more general activity against misfolded membrane proteins

    • Comprehensive substrate identification studies are needed to resolve this question

  • Mechanistic Uncertainties:

    • The precise catalytic mechanism remains incompletely defined

    • Questions about how htpX recognizes and discriminates between substrates

    • Structural studies have been limited by technical challenges in membrane protein crystallography

  • Functional Redundancy Question:

    • Extent of functional overlap with other mycobacterial proteases remains unclear

    • Some researchers argue for specialized, non-redundant functions

    • Others suggest significant backup systems exist

    • Requires careful multiple-protease knockout studies

  • Clinical Relevance Controversy:

    • Debate about whether htpX is a viable drug target

    • Questions about whether inhibition would affect dormant bacteria

    • Uncertainty about potential side effects due to inhibition of human homologs

    • Requires validation in relevant animal models

  • Evolutionary Origins Disagreement:

    • Competing theories about whether htpX evolved primarily for stress adaptation or for routine quality control

    • Questions about acquisition of substrate specificity during mycobacterial evolution

    • Phylogenetic studies with broader sampling could help resolve this issue

  • Diagnostic Potential Debate:

    • Conflicting evidence regarding whether htpX or its products could serve as biomarkers

    • Questions about specificity and sensitivity in clinical samples

    • Requires larger clinical studies with diverse patient populations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.