Recombinant Mycobacterium tuberculosis UPF0060 membrane protein MRA_2668 (MRA_2668)

What is the basic structural characterization of MRA_2668 membrane protein?

MRA_2668 is a UPF0060 family membrane protein from Mycobacterium tuberculosis with 110 amino acids. The full amino acid sequence is: MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGRVLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH . The protein has a UniProt ID of A5U5Z1 and contains hydrophobic regions consistent with its membrane localization . Analysis of the sequence reveals potential transmembrane domains that contribute to its integration within the mycobacterial cell membrane.

What are the predicted functional domains of MRA_2668 and how do they compare to other UPF0060 family proteins?

MRA_2668 belongs to the UPF0060 family of membrane proteins, which remain poorly characterized functionally. Sequence analysis reveals:

While functional characterization remains limited, comparative analysis with other mycobacterial membrane proteins suggests potential roles in cell envelope integrity or small molecule transport. Unlike some characterized membrane proteins in M. tuberculosis that are involved in virulence (such as Rv1048c ), the specific pathogenic role of MRA_2668 has not been fully elucidated.

What expression systems are most effective for recombinant production of MRA_2668?

The recombinant production of MRA_2668 has been successfully achieved in E. coli expression systems . When designing expression strategies, consider the following:

• Vector selection: Vectors containing strong promoters (T7) with N-terminal His-tags have been successfully employed

• Host strain optimization: BL21(DE3) or similar E. coli strains designed for membrane protein expression

• Induction conditions: IPTG concentration optimization (typically 0.5-1.0 mM) at reduced temperatures (16-25°C)

• Expression verification: Western blotting with anti-His antibodies

For membrane proteins like MRA_2668, expression levels can be improved by using specialized strains designed for membrane protein expression, such as C41(DE3) or C43(DE3). These approaches parallel methodologies used for other mycobacterial membrane proteins, where proper folding and membrane integration present significant challenges.

What are the optimal purification protocols for obtaining high-purity MRA_2668 protein?

Based on established protocols for His-tagged mycobacterial membrane proteins, the following purification strategy is recommended:

• Cell lysis: Sonication or mechanical disruption in buffer containing mild detergents (0.5-1% DDM or LDAO)

• Initial purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

• Secondary purification: Size exclusion chromatography to achieve >90% purity

• Quality control: SDS-PAGE analysis to confirm purity greater than 90%

• Storage: Lyophilization or storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0

When reconstituting the protein, it should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, aliquoting with 50% glycerol and storing at -20°C/-80°C is recommended to avoid repeated freeze-thaw cycles .

What imaging techniques are most appropriate for studying MRA_2668 trafficking and localization?

For membrane proteins like MRA_2668, advanced imaging approaches similar to those used for other membrane proteins can be applied:

• Self-labeling tag integration: Engineering MRA_2668 with extracellular HaloTag or SNAPTag enables specific fluorescent labeling

• Compartmentalized cultures: Utilizing microfluidic chambers to separate cellular compartments when studying trafficking

• Live-cell imaging protocols: Implementing specialized labeling procedures to track:

  • Anterograde and retrograde transport

  • Protein co-transport patterns

  • Subcellular localization

  • Exocytosis and endocytosis dynamics

These approaches overcome traditional limitations in membrane protein visualization and enable real-time tracking of protein dynamics. Analysis can be performed using open-source software designed for high-throughput processing of imaging data .

How can molecular interaction studies be optimized for identifying MRA_2668 binding partners?

To identify binding partners and characterize the interactome of MRA_2668, implement these methodological approaches:

• Proximity labeling techniques: Adapt proximity biotinylation methods using enzymes like AirID fused with antigen-binding fragments (FabID) to identify extracellular interactions

• Co-immunoprecipitation: Using anti-His antibodies to pull down MRA_2668 complexes

• Crosslinking mass spectrometry: Apply chemical crosslinkers followed by LC-MS/MS analysis

• Membrane protein-specific yeast two-hybrid systems: Modified split-ubiquitin systems designed for membrane protein interactions

For comprehensive analysis, combine multiple complementary approaches and validate key interactions using targeted methods such as bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET).

How can MRA_2668 be leveraged for developing novel tuberculosis diagnostic approaches?

MRA_2668 offers potential applications in TB diagnostics that could complement existing approaches:

• Antibody development: Generate specific antibodies against MRA_2668 using recombinant protein immunization, with predicted antibody response based on amino acid propensity scales

• PCR-based detection: Design primers targeting MRA_2668 genomic regions that are specific to M. tuberculosis complex, similar to established IS6110 and IS1081 approaches

• Immunoassay development: Create sensitive detection methods using anti-MRA_2668 antibodies for clinical samples

When developing antibody-based approaches, consider that selecting immunogens with high propensity scores (>0.48) can significantly reduce the fraction of low antibody responses from approximately 30% to 10% , improving diagnostic sensitivity.

What insights can functional studies of MRA_2668 provide about M. tuberculosis pathogenesis?

To elucidate the role of MRA_2668 in tuberculosis pathogenesis, consider these research approaches:

• Gene knockout/knockdown studies: Generate MRA_2668-deficient strains and assess:

  • Growth kinetics in various media

  • Biofilm formation capacity

  • Stress response (oxidative, acid, nutrient limitation)

  • Macrophage infection models

• Heterologous expression systems: Similar to approaches used for Rv1048c protein , express MRA_2668 in non-pathogenic mycobacteria like M. smegmatis to assess:

  • Changes in cell envelope properties

  • Altered susceptibility to antibiotics

  • Impacts on host cell interactions

  • Inflammatory cytokine responses

• Structure-function analysis: Generate site-directed mutants targeting key residues to determine critical functional domains

These approaches can provide insights into whether MRA_2668 contributes to virulence mechanisms, persistence strategies, or antibiotic tolerance in M. tuberculosis.

What strategies can overcome common challenges in MRA_2668 expression and solubility?

Membrane proteins like MRA_2668 present specific challenges that can be addressed through these methodological approaches:

For particularly difficult constructs, consider cell-free expression systems that allow direct incorporation into nanodiscs or liposomes for improved stability and native conformation.

What quality control measures are essential for ensuring MRA_2668 structural integrity for functional studies?

To ensure the recombinant MRA_2668 maintains native conformation and functionality:

• Circular dichroism spectroscopy: Assess secondary structure elements and thermal stability

• Size-exclusion chromatography with multi-angle light scattering (SEC-MALS): Confirm monodispersity and proper oligomeric state

• Limited proteolysis: Evaluate proper folding through resistance patterns to controlled proteolytic digestion

• Functional assays: Develop binding or activity assays specific to predicted functions

• Reconstitution studies: Verify proper membrane integration through liposome reconstitution experiments

These approaches ensure that experimental outcomes reflect genuine biological properties rather than artifacts from improper protein preparation.

How might comparative analysis of MRA_2668 across mycobacterial species inform tuberculosis research?

Comparative genomic and functional analysis across mycobacterial species offers valuable research opportunities:

• Phylogenetic distribution: Analyze presence/absence patterns of MRA_2668 homologs across pathogenic and non-pathogenic mycobacteria

• Sequence conservation analysis: Identify highly conserved regions that may indicate functional importance

• Evolution rate analysis: Determine whether MRA_2668 is under positive or purifying selection

• Structure prediction comparisons: Generate comparative models to identify structural adaptations in different mycobacterial species

This comparative approach could reveal whether MRA_2668 contributes to the specific pathogenic properties of M. tuberculosis compared to environmental mycobacteria, potentially identifying new therapeutic targets.

What emerging technologies might advance our understanding of MRA_2668 function in the near future?

Several cutting-edge technologies show promise for expanding our understanding of MRA_2668:

• Cryo-electron microscopy: Determine high-resolution structures of MRA_2668 in native membrane environments

• AlphaFold2/RoseTTAFold integration: Combine AI-predicted structures with experimental validation

• Single-molecule tracking: Apply super-resolution microscopy techniques to track individual MRA_2668 molecules in live mycobacteria

• CRISPR interference systems: Develop inducible knockdown systems for temporal control of MRA_2668 expression

• Microfluidic infection models: Create controlled host-pathogen interfaces for studying MRA_2668 during infection dynamics