Recombinant Mycobacterium tuberculosis UPF0353 protein MRA_1491 (MRA_1491)

Shipped with Ice Packs
In Stock

Description

Introduction to MRA_1491

Recombinant Mycobacterium tuberculosis UPF0353 protein MRA_1491 (MRA_1491) is a protein expressed in Mycobacterium tuberculosis . MRA_1491 is also known as UPF0353 protein MRA_1491, with UniProt ID A5U2I5 .

Characteristics of Recombinant MRA_1491 Protein

CharacteristicDescription
SpeciesMycobacterium tuberculosis
SourceE. coli
TagHis (N-terminal)
Protein LengthFull Length (1-335 amino acids)
FormLyophilized powder
Amino Acid SequenceMTLPLLGPMTLSGFAHSWFFLFLFVVAGLVALYILMQLARQRRMLRFANMELLESVAPKR PSRWRHVPAILLVLSLLLFTIAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATDVEPSRMV AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKNALDKLQFADRTATGEAI FTALQAIATVGAVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPIS STISFGTPYGFVEINDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELRAVYSSLQQQIGY ETIKGDASVGWLRLGALALALAALAALLINRRLPT
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol is recommended .
Gene NameMRA_1491
SynonymsMRA_1491; UPF0353 protein MRA_1491
UniProt IDA5U2I5

Protein Structure

Proteins have four levels of structure: primary, secondary, tertiary, and quaternary1 . The primary structure is the amino acid sequence1 . The sequence determines the shape of the protein, and replacing one amino acid can change the protein's shape and function1. Secondary structure describes the localized shape of a protein, such as alpha helices and beta pleated sheets, stabilized by hydrogen bonds1. Tertiary structure represents the three-dimensional folding pattern of the protein, involving disulfide bonds, hydrogen bonds, ionic bonds, and hydrophobic interactions1 . Quaternary structure involves interactions between different polypeptide chains in a multi-subunit protein .

Function and Significance

The function of MRA_1491 is not well-characterized, as it is classified as a UPF0353 protein . UPF0353 proteins are often hypothetical proteins or proteins with unknown function. Research has shown that Mycobacterium tuberculosis possesses mechanisms to counteract DNA-damaging stresses . Further studies are needed to elucidate the specific role of MRA_1491 in Mycobacterium tuberculosis.

MRA_1491 in Drug Discovery

Mycobacterium tuberculosis strains with mutations in MmpL3 showed resistance, suggesting MmpL3 is the target, or mechanism of resistance for both series .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If a specific tag is required, please inform us, and we will prioritize its implementation.
Synonyms
MRA_1491; UPF0353 protein MRA_1491
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Target Names
MRA_1491
Target Protein Sequence
MTLPLLGPMTLSGFAHSWFFLFLFVVAGLVALYILMQLARQRRMLRFANMELLESVAPKR PSRWRHVPAILLVLSLLLFTIAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATDVEPSRMV AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKNALDKLQFADRTATGEAI FTALQAIATVGAVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPIS TISFGTPYGFVEINDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELRAVYSSLQQQIGY ETIKGDASVGWLRLGALALALAALAALLINRRLPT
Uniprot No.

Target Background

Database Links
Protein Families
UPF0353 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Why is structural characterization of MRA_1491 important for research?

Structural characterization of MRA_1491 is crucial because understanding the three-dimensional structure provides significant insights into the protein's function that cannot be deduced from sequence information alone. As demonstrated in related research on bacterial proteins, determining the 3-D structure allows scientists to:

  • Identify potential functional domains and active sites

  • Discover possible binding partners or substrates

  • Elucidate mechanisms of action

  • Determine potential targets for therapeutic development

X-ray crystallography technology at facilities such as the Advanced Photon Source has been successfully utilized for similar bacterial proteins to determine detailed molecular structures and functions . For MRA_1491, structural studies might reveal its role in Mycobacterium tuberculosis pathogenesis or survival mechanisms, potentially identifying new targets for antibiotics or vaccines.

What expression systems are available for producing recombinant MRA_1491?

Multiple expression systems are available for producing recombinant MRA_1491, each with distinct advantages depending on research needs:

Expression SystemProduct IdentifierAdvantagesConsiderations
E. coliCSB-EP403166MON1High yield, cost-effective, rapid expressionMay lack post-translational modifications
YeastCSB-YP403166MON1Some eukaryotic post-translational modificationsModerate yield
Mammalian cellsCSB-MP403166MON1Most authentic post-translational modificationsLower yield, higher cost
BaculovirusCSB-BP403166MON1High capacity for complex proteinsRequires specialized handling

Most commonly, the protein is expressed in E. coli with an N-terminal His tag to facilitate purification . Each system requires optimization of expression conditions and purification protocols to achieve high purity and yield.

How can Selected Reaction Monitoring (SRM) be used to quantify MRA_1491 protein levels?

Selected Reaction Monitoring (SRM) is a highly precise mass spectrometry-based technique for accurately quantifying protein abundance. For researchers studying MRA_1491, SRM offers significant advantages over traditional methods:

  • SRM provides absolute quantification of protein levels with high specificity and sensitivity

  • It can detect discrepancies between transcript and protein levels that would be missed by transcript analysis alone

  • The method allows for reliable comparison between wild-type and mutant strains

Implementation methodology:

  • Select unique peptides that specifically represent MRA_1491

  • Use isotopically labeled standards of these peptides for absolute quantification

  • Monitor specific fragment ions from these peptides using triple quadrupole mass spectrometry

  • Compare results with transcript levels measured by RT-PCR to identify post-transcriptional regulation

Studies examining similar proteins have demonstrated that SRM analysis can reveal cases where mRNA and protein expression levels are not correlated, highlighting the importance of direct protein quantification in understanding protein function and regulation . This approach is particularly valuable when comparing MRA_1491 expression under different experimental conditions or in various mutant backgrounds.

What is the optimal approach for purifying recombinant MRA_1491 protein?

The optimal purification approach for recombinant MRA_1491 depends on the expression system and tag used. For the commonly used His-tagged version expressed in E. coli:

  • Cell lysis: Sonicate bacterial cells in appropriate buffer containing protease inhibitors

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Use Ni-NTA or similar resin

    • Apply clarified lysate to the column

    • Wash with increasing imidazole concentrations (20-50 mM)

    • Elute with high imidazole (250-500 mM)

  • Size Exclusion Chromatography (SEC):

    • Further purify using SEC to remove aggregates and ensure monodispersity

    • Analyze fractions by SDS-PAGE to confirm >90% purity

  • Buffer exchange:

    • Exchange into Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Quality control:

    • Verify purity by SDS-PAGE (>85-90% purity)

    • Confirm identity by Western blot or mass spectrometry

For long-term storage, lyophilization is recommended, with reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 50% and storing aliquots at -20°C/-80°C prevents degradation from repeated freeze-thaw cycles .

How can Design of Experiments (DOE) improve MRA_1491 formulation development?

Design of Experiments (DOE) offers a systematic approach to optimizing MRA_1491 formulation by simultaneously examining multiple variables. When applied to MRA_1491 research:

  • DOE enables identification of optimal buffer components, pH ranges, and excipient concentrations that maximize protein stability

  • It allows detection of interactions between formulation components (e.g., pH and salt concentration)

  • The approach helps establish a robust "formulation design space" - the range of conditions within which protein quality is maintained

Implementation methodology:

  • Select critical variables (pH, buffer type, excipients, protein concentration)

  • Design a factorial experiment with appropriate ranges

  • Measure stability indicators (aggregation, activity, thermal stability)

  • Analyze results to identify optimal conditions and interactions

  • Perform confirmatory studies at boundary conditions

Research on protein formulations demonstrates that DOE can effectively characterize multidimensional interactions between formulation components, ensuring optimal stability while maintaining adequate robustness . For MRA_1491, this approach would help identify conditions that prevent aggregation and maintain activity during storage and experimental manipulation.

How should researchers reconcile discrepancies between MRA_1491 mRNA and protein levels?

Discrepancies between mRNA and protein levels are common in biological systems and can significantly impact research interpretations. When studying MRA_1491, researchers should:

  • Implement complementary measurement techniques:

    • Quantify mRNA using both semi-quantitative and quantitative RT-PCR

    • Measure protein levels using SRM mass spectrometry for absolute quantification

    • Compare relative abundances using multiple methods (Western blot, ELISA)

  • Consider post-transcriptional regulatory mechanisms:

    • Translation efficiency differences

    • Protein degradation rates

    • RNA stability factors

  • Design experiments that account for potential discordance:

    • Include mutant alleles with various expression levels

    • Measure both transcript and protein in the same samples

    • Examine temporal dynamics of expression

What controls are essential when studying MRA_1491 function?

Rigorous experimental controls are critical for reliable MRA_1491 research:

Control TypePurposeImplementation
Positive controlsVerify assay functionalityInclude well-characterized proteins with similar properties
Negative controlsEstablish baseline and identify false positivesUse buffer-only samples and unrelated proteins
Expression controlsNormalize for expression level variationsMeasure housekeeping proteins simultaneously
Technical replicatesAssess methodological reproducibilityPerform at least triplicate measurements
Biological replicatesAccount for biological variationUse independent cultures/samples (minimum n=3)
Knockout/mutant controlsConfirm specificity and functionInclude MRA_1491 mutant strains with defined characteristics

Additionally, when performing structural studies or functional assays, researchers should include controls for proper protein folding and activity, such as circular dichroism spectroscopy or enzymatic activity measurements with known substrates or inhibitors.

How can structural information about MRA_1491 inform drug development against tuberculosis?

Structural characterization of MRA_1491 could significantly advance tuberculosis drug development through several mechanisms:

  • Identification of binding pockets: X-ray crystallography and cryo-electron microscopy can reveal potential binding sites for small molecule inhibitors.

  • Structure-based drug design: Once the 3D structure is determined, computational methods can be used to screen in silico for molecules that bind to critical regions of MRA_1491.

  • Function determination: Structural studies often reveal homology to proteins of known function, potentially identifying MRA_1491's role in M. tuberculosis survival or virulence.

  • Interaction mapping: Protein-protein interaction studies based on structural data could identify whether MRA_1491 interacts with host factors or other bacterial proteins.

Research on similar bacterial proteins has demonstrated that antibiotics like cephalosporin can inhibit protein function, providing a foundation for developing targeted treatments . If MRA_1491 proves essential for bacterial survival or virulence, structural information could accelerate the development of specific inhibitors with potential therapeutic applications.

What are the challenges in studying post-translational modifications of MRA_1491?

Studying post-translational modifications (PTMs) of MRA_1491 presents several research challenges:

  • Expression system selection:

    • E. coli systems may not reproduce native mycobacterial PTMs

    • Mammalian or mycobacterial expression systems may better preserve authentic modifications but offer lower yields

  • Analytical challenges:

    • Mass spectrometry-based PTM identification requires specialized protocols

    • Low abundance modifications may be difficult to detect

    • Differentiating between in vivo modifications and artifacts introduced during purification

  • Functional verification:

    • Determining whether identified PTMs are physiologically relevant

    • Assessing how PTMs affect protein function, localization, or interactions

  • Methodological approaches:

    • Enrichment strategies for specific PTMs (phosphorylation, glycosylation)

    • Site-directed mutagenesis to confirm modification sites

    • Comparison of native vs. recombinant protein modifications

Researchers should consider using more complex expression systems like mammalian cells (CSB-MP403166MON1) when studying PTMs, despite the higher cost and lower yield compared to bacterial systems .

How might MRA_1491 contribute to Mycobacterium tuberculosis pathogenesis?

Based on sequence analysis and structural predictions, several hypotheses about MRA_1491's role in pathogenesis merit investigation:

  • Membrane association: The amino acid sequence suggests potential membrane localization, which could indicate involvement in:

    • Host-pathogen interactions

    • Nutrient acquisition

    • Stress response mechanisms

    • Drug efflux

  • Potential functional domains:

    • The protein contains regions that may be involved in protein-protein interactions

    • Analysis of homologous proteins in other bacteria suggests possible roles in cell wall maintenance or remodeling

  • Research approaches to explore pathogenesis roles:

    • Gene knockout studies to assess virulence in cellular and animal models

    • Protein localization studies using fluorescent tags or immune-electron microscopy

    • Interactome analysis to identify binding partners

    • Expression profiling under conditions that mimic the host environment

Understanding MRA_1491's contribution to pathogenesis could reveal new vulnerabilities in M. tuberculosis that might be exploited for therapeutic intervention.

What techniques can resolve contradictory experimental results when studying MRA_1491?

When faced with contradictory results in MRA_1491 research, a systematic troubleshooting approach is essential:

  • Methodological reconciliation:

    • Compare protein quantification methods (Western blot vs. SRM vs. ELISA)

    • Assess transcript measurement techniques (Northern blot vs. RT-PCR vs. RNA-seq)

    • Evaluate protein expression systems used (E. coli vs. mammalian vs. mycobacterial)

  • Biological factors assessment:

    • Examine strain differences in M. tuberculosis isolates

    • Consider growth conditions and environmental factors

    • Assess time-dependent changes in expression

  • Advanced analytical approaches:

    • Apply orthogonal techniques to verify contradictory findings

    • Conduct single-cell analysis to identify population heterogeneity

    • Implement isotope labeling strategies for definitive protein quantification

  • Statistical revaluation:

    • Increase biological and technical replicates

    • Apply appropriate statistical tests with consideration of multiple hypothesis testing

    • Use power analysis to ensure adequate sample sizes

Research on similar proteins has demonstrated that apparent contradictions can arise from differences in post-transcriptional regulation or methodology . By implementing rigorous controls and multiple measurement techniques, researchers can resolve discrepancies and develop a more accurate understanding of MRA_1491 biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.