Recombinant Mycobacterium ulcerans Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; MUL_4697; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Mycobacterium ulcerans (strain Agy99)
Target Names
mscL
Target Protein Sequence
MLKGFKEFLSRGNIVDLAVAVVIGTAFTALVTRFTDSIITPLINRVGVNEQSDLGILKIG IGRGQSIDLNVLLSATINFILVAGVVYFLVVVPYNTLRKKGEVEQADDAQIVLLTEIRDL LAQTNSNSSGRHEAPGTAGTPPPNYGPRADT
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.
Database Links

KEGG: mul:MUL_4697

Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Mycobacterium ulcerans Large-conductance mechanosensitive channel (mscL) and what is its biological significance?

The Mycobacterium ulcerans Large-conductance mechanosensitive channel (mscL) is a membrane protein that functions as an emergency release valve in bacterial cells. This channel responds to mechanical tension in the cell membrane caused by osmotic pressure changes, opening to release cytoplasmic solutes when bacteria experience sudden decreases in external osmolarity. MscL forms the largest gated pore known in biological systems, capable of passing molecules up to 30 Å in diameter . The channel has a conductance of approximately 3.6 nS, which is 1-2 orders of magnitude larger than most eukaryotic channels .

In the context of M. ulcerans, the causative agent of Buruli ulcer, mscL likely plays a crucial role in bacterial survival during environmental transitions and possibly during host infection. M. ulcerans is found in aquatic environments and must adapt to osmotic changes, making mechanosensitive channels particularly important for its survival .

How conserved is the mscL protein across mycobacterial species and what are the implications for research?

The mscL protein is highly conserved across mycobacterial species. The crystal structure of M. tuberculosis mscL (PDB: 2OAR) has been well-characterized , and this conservation extends to M. ulcerans mscL. Both M. ulcerans and M. tuberculosis are closely related mycobacterial species, with significant conservation of drug molecular targets between them .

This conservation has important implications for research:

  • Structural insights from M. tuberculosis mscL can inform studies of M. ulcerans mscL

  • Drug discovery efforts targeting mscL could potentially be effective against multiple mycobacterial pathogens

  • Expression systems and purification methods developed for one species may be adaptable to others

The amino acid sequence of M. ulcerans mscL (strain Agy99) consists of 151 amino acids, forming a pentameric channel structure similar to that observed in M. tuberculosis .

What is the relationship between M. ulcerans mscL and Buruli ulcer pathogenesis?

While the direct role of mscL in M. ulcerans pathogenesis is not fully characterized, several connections can be established:

  • Bacterial survival: As an osmoregulatory channel, mscL likely contributes to M. ulcerans survival in changing environments, including transition from environmental reservoirs to human hosts .

  • Antibiotic entry: Research on related mechanosensitive channels indicates they can serve as entry pathways for antibiotics. For example, streptomycin has been shown to open MscL channels and use them as primary paths to the bacterial cytoplasm in other species . This suggests mscL could influence antibiotic susceptibility in Buruli ulcer treatment.

  • Host interaction: M. ulcerans proteins like MUL_3720 have been shown to interact with host skin components such as keratin-associated glycans . While not directly linked to mscL, this demonstrates how bacterial surface proteins can mediate host-pathogen interactions relevant to Buruli ulcer.

Buruli ulcer is characterized by necrotic skin lesions caused by the mycolactone toxin, a polyketide that triggers inflammation and induces apoptosis in host cells . The potential interplay between mscL function and mycolactone activity represents an interesting area for future research.

What are the current methods for expressing and purifying recombinant M. ulcerans mscL?

Recombinant M. ulcerans mscL can be expressed in several systems, with specific considerations for this membrane protein:

Expression SystemAdvantagesConsiderations
E. coliMost common and economical; rapid growthMay require specialized strains; codon optimization may be necessary
YeastPost-translational modifications; eukaryotic membrane systemLonger growth time; more complex media
BaculovirusHigh expression levels; eukaryotic processingTechnical complexity; higher cost
Mammalian cellsNative-like membrane environmentLowest yield; highest cost

Based on research with related mechanosensitive channels, expression in E. coli often employs:

  • Specialized strains like DH10β

  • IPTG induction (typically 1 mM)

  • Lower temperatures (16-30°C) to promote proper membrane insertion

  • Addition of appropriate antibiotics (e.g., ampicillin at 100 μg/ml)

For purification, a typical workflow includes:

  • Cell lysis and membrane isolation via ultracentrifugation

  • Detergent solubilization of membrane proteins

  • Affinity chromatography (e.g., using His-tag)

  • Size exclusion chromatography to separate monomers from aggregates

  • Ion exchange chromatography for final purity

Commercial sources offer recombinant M. ulcerans mscL protein (aa 1-151) with high purity for research applications .

How can the function of recombinant M. ulcerans mscL be assessed in vitro?

Several complementary approaches can be used to assess mscL function:

1. Electrophysiological methods:

  • Patch-clamp recordings can measure channel activity directly

  • Pressure thresholds for activation can be determined and normalized against MscL channels (e.g., P<sub>S</sub>/P<sub>L</sub> ratio)

  • Single channel recordings provide conductance measurements (expected ~3.6 nS)

2. Fluorescence-based assays:

  • Reconstitution of purified mscL into liposomes loaded with fluorescent dyes

  • Channel opening in response to osmotic shock releases dye, which can be quantified

  • Allows high-throughput screening of channel modulators

3. Cellular viability assays:

  • Expression of recombinant mscL in mscL-deficient bacterial strains (e.g., MJF465 E. coli strain)

  • Challenge with hypoosmotic shock

  • Measurement of survival rates to assess channel function

4. Structural approaches:

  • Cysteine scanning mutagenesis to identify functional residues

  • Disulfide cross-linking to assess conformational changes during gating

  • Zinc cross-linking with engineered histidine residues to probe domain interactions

What is the potential of recombinant M. ulcerans mscL as a drug target for treating Buruli ulcer?

Recombinant M. ulcerans mscL presents several promising characteristics as a drug target:

  • Essential function: As an emergency release valve for osmotic regulation, mscL is likely critical for bacterial survival under certain conditions .

  • Drug delivery pathway: Research on related channels suggests mscL could serve as an entry point for antibiotics. For example, streptomycin has been shown to use MscL as a primary pathway into bacterial cells .

  • Structural knowledge: The availability of crystal structures from homologous proteins (M. tuberculosis mscL) facilitates structure-based drug design approaches.

  • Unique gating mechanism: The large conformational changes during channel gating provide multiple potential druggable states .

  • Conservation: High conservation across mycobacterial species suggests drugs targeting mscL might have broad applicability .

Potential therapeutic strategies include:

  • Compounds that inappropriately trigger channel opening, disrupting ionic homeostasis

  • Molecules that modulate channel gating, potentially enhancing antibiotic entry

  • Combining mscL-targeting compounds with conventional antibiotics for synergistic effects

Current treatment for Buruli ulcer involves combination antibiotics, including rifampicin with clarithromycin or moxifloxacin . Novel targets like mscL could help address challenges such as treatment duration, which currently stands at 8 weeks.

How might recombinant M. ulcerans mscL interact with the mycolactone toxin?

While direct interactions between mscL and mycolactone have not been documented in the provided search results, several hypotheses can be formulated based on their properties:

  • Membrane environment interactions: Mycolactone is a lipid toxin (polyketide) that likely partitions into the bacterial membrane . This could potentially alter membrane properties (fluidity, thickness, curvature) that influence mscL gating.

  • Functional interplay: Mycolactone triggers inflammation and cellular apoptosis . The release of cellular contents during apoptosis could create osmotic gradients that activate mscL channels.

  • Evolutionary co-adaptation: Both mycolactone and mscL contribute to M. ulcerans survival, suggesting potential co-evolution of these systems.

Mycolactone is synthesized by three large polyketide synthases encoded by the genes mlsA1, mlsA2, and mlsB located on the 174 kb pMUM001 virulence plasmid . The toxin's immunomodulatory effects include:

  • Suppression of T cell responses at non-toxic levels

  • Alteration of early signaling at the T cell receptor level

  • Blocking cytokine responses at the post-transcriptional level

Research methodologies to investigate potential interactions could include:

  • Lipidomic analysis of membrane composition in the presence of mycolactone

  • Electrophysiological studies of mscL activity in membranes containing mycolactone

  • Molecular dynamics simulations of mscL-mycolactone interactions in membrane bilayers

What role might mscL play in M. ulcerans adaptation to different environmental conditions?

M. ulcerans inhabits diverse environments including aquatic ecosystems in tropical and subtropical regions , making adaptation to varying conditions essential. MscL likely contributes to this adaptability in several ways:

  • Osmotic protection: As an emergency release valve, mscL prevents cell lysis during transitions between environments with different osmolarities .

  • Membrane stress response: Beyond osmotic changes, mscL responds to general membrane tension, potentially helping bacteria adapt to physical stresses encountered in different niches.

  • Environmental transmission: M. ulcerans transmission is poorly understood but may involve aquatic environments . MscL could be important during transitions between environmental reservoirs and hosts.

  • Intracellular survival phase: M. ulcerans has an initial intracellular growth phase in macrophages before transitioning to an extracellular phase . MscL might contribute to survival during these transitions.

Experimental approaches to investigate these roles include:

  • Expression analysis of mscL under different environmental conditions

  • Creation of mscL mutants to assess their ability to survive osmotic challenges

  • Comparison of mscL function in environmental versus clinical isolates

  • Investigation of mscL activity during intracellular and extracellular phases of infection

What mutagenesis strategies can be used to study structure-function relationships in recombinant M. ulcerans mscL?

Several mutagenesis approaches have proven valuable in studying mechanosensitive channels:

1. Cysteine scanning mutagenesis:

  • Systematic replacement of residues with cysteine

  • Allows probing of functional regions within transmembrane domains

  • Provides information on residue accessibility and importance

  • Example: Studies of MscS identified N117 in TM3b helix and N167 in Cyto-helix as critical for channel gating

2. Disulfide cross-linking:

  • Introduction of cysteine pairs at specific positions

  • Formation of disulfide bridges under oxidizing conditions

  • Constrains protein conformational changes

  • Measures impact on channel function

  • Example: Disulfide cross-linking between N117C and N167C significantly decreased pressure-induced current in MscS

3. Metal ion coordination sites:

  • Introduction of histidine residues for zinc coordination

  • Allows reversible cross-linking by addition/chelation of zinc

  • Example: Zinc cross-linking of N117H/N167H MscS affected channel function

4. Conservation-guided mutagenesis:

  • Targeting residues conserved across mycobacterial species

  • Particularly valuable for identifying functionally important residues

  • Can leverage structural information from M. tuberculosis mscL (PDB: 2OAR)

5. Domain swap experiments:

  • Creating chimeric channels with domains from different species

  • Helps identify species-specific functional adaptations

  • Particularly relevant given the close relationship between M. ulcerans and M. tuberculosis

How can recombinant M. ulcerans mscL be incorporated into vaccine development strategies?

While no studies directly examining mscL as a vaccine candidate for Buruli ulcer were identified in the search results, several approaches can be considered based on research with other M. ulcerans antigens:

1. DNA prime/protein boost vaccination strategy:
This approach has shown promise with other M. ulcerans antigens :

  • Initial vaccination with plasmid DNA encoding mscL

  • Booster vaccination with purified recombinant mscL protein

  • Can induce both cellular and humoral immune responses

2. Combination vaccine approaches:
Multiple M. ulcerans antigens might provide better protection than single antigens :

  • Combining mscL with mycolyl transferase Ag85A

  • Targeting both membrane proteins and cell wall components

  • Addressing multiple aspects of bacterial physiology

3. Adjuvant selection:
Careful adjuvant selection is crucial:

  • Lipopeptide adjuvants (e.g., R<sub>4</sub>Pam<sub>2</sub>Cys) have been used with M. ulcerans proteins

  • These can enhance antibody responses and shape isotype distribution

4. Evaluation metrics:
Assessment of vaccine efficacy should include:

  • Antibody titers and isotype distribution (IgG1, IgG2, IgG3)

  • T cell responses (Th1/Th2 balance)

  • Protection against challenge in animal models

  • Delay in disease progression (time-to-ulceration)

5. Challenges to consider:
M. ulcerans vaccines face specific challenges:

  • Mycolactone-induced immunosuppression may limit vaccine efficacy

  • Both intracellular (early) and extracellular (late) stages of infection may require different immune responses

  • Previous studies with MUL_3720 and Hsp18 showed high antibody titers did not correlate with protection

How can interactions between recombinant M. ulcerans mscL and host factors be studied?

Investigating interactions between mscL and host factors requires specialized methodologies:

1. Glycan-binding studies:
M. ulcerans has been shown to interact with host glycans, including those associated with skin keratin :

  • Glycan array technology can screen for binding to hundreds of glycan structures

  • Surface plasmon resonance (SPR) provides quantitative binding kinetics

  • Whole bacteria and purified recombinant proteins can be compared

2. Host-pathogen interaction models:
Several models can assess mscL roles during infection:

  • Mouse footpad infection model

  • Mouse tail infection model

  • Human skin keratin extract binding assays

  • Controlled human infection model (CHIM) with M. ulcerans JKD8049

3. Immunological assays:
To assess immune responses to mscL:

  • ELISA for antibody titers and isotype distribution

  • ELISpot for T cell responses (IFN-γ, IL-2)

  • Cytokine profiling using Luminex technology

  • Assessment of antibody functionality (opsonization, complement activation)

4. Cellular localization studies:
To understand mscL accessibility during infection:

  • Immunofluorescence microscopy with anti-mscL antibodies

  • Fractionation studies to determine membrane vs. cytoplasmic distribution

  • Assessment of mscL exposure on bacterial surface

5. Functional impact studies:
To determine effects of host factors on mscL function:

  • Electrophysiology in the presence of host-derived molecules

  • Viability assays under osmotic stress with/without host factors

  • Gene expression analysis of mscL during host interaction

What computational approaches can advance our understanding of recombinant M. ulcerans mscL?

Computational methods offer powerful tools for studying mscL:

1. Homology modeling and structural prediction:

  • Generation of M. ulcerans mscL structural models based on M. tuberculosis mscL crystal structure (PDB: 2OAR)

  • Prediction of conformational states (closed, intermediate, open)

  • Identification of potential drug binding pockets

2. Molecular dynamics simulations:

  • Modeling of mscL behavior in lipid bilayers

  • Investigation of channel gating mechanisms

  • Assessment of membrane tension effects on channel conformation

  • Simulation of interactions with potential drug candidates

3. Virtual screening and drug discovery:

  • In silico screening of compound libraries against mscL models

  • Identification of potential channel modulators

  • Docking studies to predict binding modes and affinities

  • Prioritization of compounds for experimental validation

4. Sequence analysis and evolutionary studies:

  • Comparative genomics across mycobacterial species

  • Identification of conserved regions as potential drug targets

  • Prediction of functionally important residues

  • Analysis of selection pressure on mscL across M. ulcerans lineages

5. Systems biology approaches:

  • Integration of mscL function into broader bacterial stress response networks

  • Modeling of osmotic regulation systems

  • Prediction of compensatory mechanisms in response to mscL inhibition

  • Multi-scale modeling of bacterial behavior during infection

How might recombinant M. ulcerans mscL contribute to novel diagnostic approaches for Buruli ulcer?

Recombinant M. ulcerans mscL could enable new diagnostic strategies for Buruli ulcer:

1. Serological detection:

  • Development of assays to detect anti-mscL antibodies in patient sera

  • Potential for early detection before ulceration

  • Comparison with current diagnostic methods based on IS2404, IS2606, and KR-B detection

2. Point-of-care diagnostics:

  • Integration of recombinant mscL into lateral flow assays

  • Development of aptamer-based sensors specific for mscL

  • Creation of diagnostic panels combining multiple M. ulcerans antigens

3. Environmental surveillance:

  • Detection of M. ulcerans in environmental samples using mscL-targeted assays

  • Complementing current multiplex qPCR approaches

  • Understanding environmental reservoirs and transmission

4. Monitoring treatment response:

  • Tracking changes in anti-mscL antibody levels during treatment

  • Potential correlation with bacterial clearance

  • Complement to current treatment monitoring approaches

What is the potential for using recombinant M. ulcerans mscL in drug delivery systems?

The unique properties of mechanosensitive channels suggest several innovative applications:

1. Nanovalve applications:

  • MscL channels can be engineered as triggered nanovalves in nanodevices

  • Potential incorporation into liposomes for controlled drug delivery

  • Osmotically or mechanically triggered release mechanisms

2. Enhancing antibiotic delivery:

  • Given that streptomycin can use MscL as an entry pathway , designing drug conjugates that leverage this channel for entry

  • Overcoming bacterial membrane barriers to drug penetration

  • Potential to reduce required antibiotic concentrations

3. Targeted delivery systems:

  • Coupling mscL-based delivery systems with M. ulcerans-specific targeting moieties

  • Localized delivery to infection sites

  • Reduction of systemic exposure and side effects

4. Sustained release formulations:

  • Engineering mscL gating properties for controlled release kinetics

  • Potential for reducing current 8-week treatment duration for Buruli ulcer

  • Improved patient compliance with less frequent dosing

How can structural biology advances enhance our understanding of recombinant M. ulcerans mscL?

Recent advances in structural biology offer new opportunities for mscL research:

1. Cryo-electron microscopy (cryo-EM):

  • Determination of M. ulcerans mscL structure in different conformational states

  • Visualization of channel in near-native membrane environments

  • Potential for capturing intermediate states during gating

2. Single-particle analysis:

  • High-resolution structural determination without crystallization

  • Visualization of conformational heterogeneity

  • Assessment of impact of lipid environment on channel structure

3. Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Probing dynamics and conformational changes in solution

  • Identification of regions with altered solvent accessibility during gating

  • Complementary to static structural methods

4. Integrative structural biology:

  • Combining multiple techniques (X-ray crystallography, cryo-EM, HDX-MS, SAXS, etc.)

  • Development of comprehensive structural models

  • Understanding dynamic aspects of channel function

5. Time-resolved structural methods:

  • Capturing transient states during channel activation

  • Understanding the kinetics of conformational changes

  • Correlating structural changes with electrophysiological measurements

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.