Recombinant Mycobacterium ulcerans NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mycobacterium ulcerans NADH-Quinone Oxidoreductase Subunit K (nuoK)

Recombinant Mycobacterium ulcerans NADH-quinone oxidoreductase subunit K (nuoK) is a bioengineered protein derived from the bacterial pathogen responsible for Buruli ulcer. This subunit is a component of the NADH dehydrogenase (NDH-1) complex, a key enzyme in the electron transport chain, facilitating proton translocation and energy generation. The recombinant version is produced in heterologous systems (e.g., E. coli) for structural, functional, and vaccine-related studies.

Biochemical and Functional Role of nuoK

nuoK is a hydrophobic subunit of the NDH-1 complex, which couples NADH oxidation to quinone reduction and proton translocation. Structural studies highlight its three transmembrane helices (TM1–TM3) and conserved glutamic acid residues critical for proton pumping:

  • Glu-36 (TM2): Essential for NDH-1 activity; its mutation abolishes proton translocation .

  • Glu-72 (TM3): Moderately reduces activity when mutated, indicating a secondary role .

  • Cytosolic Loop (Arg-25, Arg-26): Required for maintaining structural integrity and proton transfer .

Mechanistic Insights
The NDH-1 complex utilizes nuoK’s glutamic residues to facilitate proton release into the cytoplasm, generating a proton gradient for ATP synthesis. Mutagenesis studies reveal that relocating Glu-36 within TM2 preserves activity, suggesting flexibility in helix arrangement .

Research Applications and Production Variants

Recombinant nuoK is employed in diverse studies, including structural biology, drug interactions, and vaccine development.

Product Variants

SupplierProduct CodeExpression HostTagPurityApplicationsReference
Creative BiomartRFL33083MFE. coliN-terminal His>90%Vaccine research
CusabioCSB-MP506691MVI1Mammalian cellUndetermined>85%ELISA, functional assays
MyBiosourceMBS1235736E. coli or yeastUndetermined>90%Antigen studies
Creative BiolabsE. coliN-terminal HisVaccine development

Vaccine Potential and Challenges

While nuoK has been explored as a vaccine candidate, recent studies highlight limitations:

  • Antibody Response: Recombinant nuoK induces high IgG1 antibody titers but fails to prevent M. ulcerans infection in murine models .

  • Immune Evasion: M. ulcerans produces mycolactone, which suppresses T-cell responses and antibody efficacy at the infection site .

  • Target Selection: Alternative antigens, such as mycolactone biosynthesis enzymes, show greater promise in neutralizing virulence .

Key Findings

StudyDesignOutcomeReference
Pidot et al. (2010)MUL_3720/Hsp18 subunit vaccinesNo protection; high antibody titers
Dangy et al. (2016)Anti-mycolactone monoclonal antibodiesNeutralized cytotoxicity in vitro

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoK; MUL_2469; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Mycobacterium ulcerans (strain Agy99)
Target Names
nuoK
Target Protein Sequence
MNPANYLYLSALLFTIGASGVLLRRNAIVMFMCVELMLNAVNLAFVTFARMHGHLDGQMI AFFTMVVAACEVVVGLAIIMTIFRTRKSASVDDANLLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, the primary electron acceptor is believed to be menaquinone. The enzyme couples this redox reaction to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy as a proton gradient.
Database Links

KEGG: mul:MUL_2469

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase in Mycobacterium ulcerans?

NADH-quinone oxidoreductase plays an essential role in the oxidative phosphorylation system of mycobacteria. Though specific data for M. ulcerans nuoK is limited, research on related mycobacterial species indicates that this enzyme catalyzes the transfer of electrons from NADH to the quinone pool, a critical step in energy metabolism . In M. tuberculosis, this enzyme is a key component of respiratory electron transport chains, and similar functions are expected in M. ulcerans. The enzyme is typically membrane-bound, composed of a single polypeptide chain of approximately 45 kDa with a FAD cofactor that facilitates electron transfer .

How does nuoK differ from other NADH-quinone oxidoreductase subunits?

The nuoK subunit represents one component of the multi-subunit NADH-quinone oxidoreductase complex. While search results don't specifically address the nuoK subunit, we can infer from related research that each subunit contributes uniquely to enzyme function. Type II NADH-quinone oxidoreductase (NDH-2) systems, as found in M. tuberculosis, contain distinct functional domains coordinating electron transfer from NADH to quinone substrates . The subunit K likely plays a specific structural or functional role within this larger complex, possibly contributing to membrane anchoring or substrate interaction.

Why is M. ulcerans nuoK of interest to researchers studying Buruli ulcer?

M. ulcerans causes Buruli ulcer, a necrotizing disease of the skin and subcutaneous tissue prevalent in rural West African regions . While current treatments involve eight weeks of antibiotic therapy, scarring and permanent disabilities remain common outcomes . Targeting metabolic enzymes such as NADH-quinone oxidoreductase represents a potential therapeutic approach. Similar to the strategy targeting NDH-2 in M. tuberculosis, the absence of direct equivalents of bacterial NDH-2 in mammalian mitochondria (which use the larger Complex I) makes nuoK a potentially selective antimycobacterial target with minimal host toxicity .

What expression systems are most effective for producing recombinant M. ulcerans proteins?

For recombinant expression of M. ulcerans proteins, vesicular stomatitis virus (VSV)-based RNA replicon particles have demonstrated efficacy. This system has been successfully employed for expressing M. ulcerans proteins including MUL2232 and MUL3720 . The VSV system allows for the characterization of recombinant antigens both in vitro and in vivo. For expression of membrane proteins like nuoK, specialized approaches may be necessary to maintain proper folding and function. Though not directly addressed for nuoK, the VSV system could potentially be adapted for expression of this membrane-associated protein.

How can researchers verify successful expression of recombinant nuoK?

Verification of successful expression typically involves multiple complementary approaches. Western blotting using antibodies specific to either nuoK or attached epitope tags provides confirmation of protein production at expected molecular weights . Functional assays measuring NADH oxidation activity offer verification of properly folded, active enzyme. For membrane proteins like nuoK, additional verification through membrane fractionation studies may be necessary. Activity can be assessed using various quinone analogs as electron acceptors, similar to the approach used with M. tuberculosis NDH-2 .

What are the typical yields of recombinant nuoK in different expression systems?

While specific yield data for recombinant M. ulcerans nuoK is not provided in the search results, comparable systems using VSV-based replicon particles for mycobacterial proteins suggest viable expression levels for research purposes . Membrane protein yields are generally lower than those of soluble proteins, requiring optimization of expression conditions. When overexpressing similar proteins like M. tuberculosis NDH-2 in bacterial systems, researchers have achieved 50-100 fold increases in NADH reductase activity compared to wild-type membranes, indicating substantial protein production .

How do mutations in the nuoK gene affect M. ulcerans virulence and metabolism?

The relationship between nuoK mutations and M. ulcerans virulence represents an important research question. While direct studies on nuoK mutations aren't provided in the search results, research on oxidative phosphorylation in mycobacteria suggests that disruptions to electron transport components could significantly impact bacterial viability and virulence. Given that NADH-quinone oxidoreductase plays an essential role in energy metabolism, mutations affecting nuoK function would likely alter growth characteristics, potentially reducing bacterial fitness or affecting production of virulence factors such as mycolactone, the toxin responsible for the tissue destruction seen in Buruli ulcer .

What is the enzyme kinetic mechanism of M. ulcerans NADH-quinone oxidoreductase?

Based on studies of the related M. tuberculosis enzyme, NADH-quinone oxidoreductase likely operates via a nonclassical, two-site ping-pong kinetic mechanism . In this model, substrate quinones bind to a site distinct from the NADH-binding site. Kinetic analyses with varying concentrations of both substrates (NADH and quinones) at fixed ratios can distinguish between sequential and ping-pong mechanisms. For M. tuberculosis NDH-2, researchers have determined kinetic parameters indicating:

ParameterValue with UQ₀ (Membrane)Value with UQ₀ (Soluble)
KM NADH (mM)0.24 ± 0.070.14 ± 0.02
KM UQ₀ (mM)0.64 ± 0.200.58 ± 0.11
kcat (s⁻¹)580.0 ± 170480.0 ± 60

Similar kinetic properties would be expected for M. ulcerans NADH-quinone oxidoreductase, though specific values would need to be experimentally determined .

How does the structure of nuoK contribute to NADH-quinone oxidoreductase function?

The structural characteristics of nuoK and their contribution to enzyme function represent an area requiring further investigation. Based on related studies of NDH-2 enzymes, the nuoK subunit likely contributes to the membrane association of the complex and may participate in quinone binding . Structural studies often employ techniques such as X-ray crystallography or cryo-electron microscopy to determine protein structure. For membrane proteins like nuoK, structural determination is challenging and may require detergent solubilization, lipid nanodisc incorporation, or other specialized approaches. Computational modeling based on homologous proteins can provide preliminary structural insights pending experimental confirmation.

What are the optimal conditions for measuring M. ulcerans NADH-quinone oxidoreductase activity?

Optimal assay conditions for NADH-quinone oxidoreductase activity typically involve spectrophotometric monitoring of NADH oxidation at 340 nm. Based on protocols developed for M. tuberculosis NDH-2, assays can be performed with both membrane-bound and detergent-solubilized enzyme preparations . Typical reaction conditions include:

  • Buffer: 50 mM potassium phosphate (pH 7.0-7.5)

  • Temperature: 30-37°C

  • NADH concentration range: 0.05-0.5 mM

  • Quinone substrate (e.g., UQ₀, UQ₁, UQ₂, or menadione): 0.05-1.0 mM

  • Protein concentration: Adjusted to achieve linear reaction rates

The specific activity can be calculated using the extinction coefficient of NADH (6,220 M⁻¹cm⁻¹). For membrane preparations overexpressing the enzyme, activities 50-100 fold higher than wild-type membranes have been observed with M. tuberculosis NDH-2 .

How can researchers distinguish between NDH-1 and NDH-2 activity in M. ulcerans preparations?

Distinguishing between type I (NDH-1) and type II (NDH-2) NADH-quinone oxidoreductase activities requires selective inhibition approaches. While specific methods for M. ulcerans aren't detailed in the search results, established techniques from related mycobacterial research can be applied. NDH-1 is typically sensitive to rotenone and piericidin A, while NDH-2 is resistant to these inhibitors. Conversely, flavone and flavonoids more selectively inhibit NDH-2. By comparing activity in the presence and absence of these inhibitors, the relative contributions of each enzyme type can be determined. Additionally, kinetic parameters differ between the enzyme types, with NDH-2 typically showing higher KM values for NADH compared to NDH-1 .

What strategies can optimize recombinant nuoK solubility and stability?

Optimizing solubility and stability of membrane proteins like nuoK represents a significant challenge. Effective strategies may include:

  • Expression with solubility-enhancing fusion partners (e.g., MBP, SUMO, thioredoxin)

  • Codon optimization for the expression host

  • Lower induction temperatures (16-25°C) to slow expression and improve folding

  • Screening multiple detergents for optimal solubilization (e.g., DDM, LDAO, Triton X-100)

  • Addition of stabilizing agents (glycerol, specific lipids) to purification buffers

  • Incorporation into nanodiscs or liposomes to maintain native-like membrane environment

The choice between membrane-bound and detergent-solubilized preparations depends on the research question, as demonstrated in studies with M. tuberculosis NDH-2 where both forms retained activity but showed slight differences in kinetic parameters .

How should researchers interpret kinetic data for nuoK-containing enzyme complexes?

Interpretation of kinetic data for NADH-quinone oxidoreductase requires careful consideration of the reaction mechanism. For ping-pong mechanisms, as observed with M. tuberculosis NDH-2, Lineweaver-Burk plots show parallel lines when one substrate is varied at different fixed concentrations of the second substrate . Analysis of initial velocity data should employ appropriate equations for ping-pong kinetics:

v = (V_max × [A] × [B]) / (K_m^B × [A] + K_m^A × [B] + [A] × [B])

Where v is the initial velocity, V_max is the maximum velocity, [A] and [B] are substrate concentrations, and K_m^A and K_m^B are the Michaelis constants for substrates A and B, respectively.

What are the common pitfalls in analyzing inhibition of NADH-quinone oxidoreductase?

When analyzing inhibition patterns for NADH-quinone oxidoreductase, researchers should be aware of several potential complications:

  • Product inhibition: Accumulation of NAD⁺ or reduced quinones can inhibit the reaction, necessitating continuous product removal or initial rate measurements

  • Detergent effects: For solubilized enzyme, detergent concentration can affect apparent kinetic parameters and inhibitor binding

  • Quinone solubility: Many quinone compounds have limited aqueous solubility, potentially leading to precipitation at higher concentrations

  • Redox cycling: Some compounds can undergo non-enzymatic redox cycling with oxygen, creating artifacts in activity measurements

  • Mechanism-based inhibition: Some inhibitors may form covalent adducts with the enzyme, requiring time-dependent inhibition analysis

For accurate inhibition analysis, researchers should employ multiple quinone substrates and carefully control reaction conditions to ensure reliable data interpretation .

How do researchers reconcile contradictory findings about nuoK function?

Contradictory findings regarding enzyme function are common in complex biological systems. When faced with discrepancies in nuoK research, scientists should consider:

  • Experimental conditions: Differences in pH, temperature, ionic strength, or detergent systems can significantly impact enzyme behavior

  • Protein preparation methods: Variation in expression systems, purification techniques, or protein integrity may explain functional differences

  • Assay methodologies: Different activity assay methods may measure distinct aspects of enzyme function

  • Post-translational modifications: Modifications present in native but not recombinant systems might alter activity

  • Protein-protein interactions: Absence of interaction partners in recombinant systems could affect function

Resolving contradictions typically requires systematic investigation of these variables, ideally using multiple complementary approaches to verify findings. Collaborative cross-validation between laboratories can also help identify sources of experimental variation .

What are the major challenges in expressing and purifying functional recombinant nuoK?

Expression and purification of functional membrane proteins like nuoK present several major challenges:

  • Toxicity to expression hosts: Overexpression of membrane proteins can disrupt host cell membrane integrity

  • Inclusion body formation: Improper folding often leads to aggregation and loss of function

  • Detergent selection: Finding detergents that maintain protein stability while effectively solubilizing from membranes

  • Cofactor incorporation: Ensuring proper association of the FAD cofactor during expression

  • Maintaining quaternary structure: Preserving protein-protein interactions within the multi-subunit complex

  • Low yields: Membrane proteins typically express at lower levels than soluble proteins

Solutions include screening multiple expression systems (bacterial, yeast, insect, mammalian), optimizing induction conditions, employing specialized membrane protein purification techniques, and reconstituting the purified protein into artificial membrane systems to maintain native-like environments .

How can researchers overcome the limitation of low immunogenicity of nuoK for antibody production?

Developing high-quality antibodies against membrane proteins like nuoK is challenging due to their often low immunogenicity. Strategies to overcome this limitation include:

  • Using synthetic peptides corresponding to predicted extramembrane regions of nuoK

  • Expressing and purifying recombinant fragments of the protein for immunization

  • DNA immunization approaches expressing the protein in vivo

  • Prime-boost immunization strategies combining different antigen forms

  • Using more immunogenic carrier proteins or adjuvants

Research with M. ulcerans antigens has demonstrated that prime-boost immunization regimens combining virus replicon particles and recombinant protein can induce strong immune responses . This approach could be adapted for nuoK to generate research-grade antibodies for detection and characterization studies.

What approaches can address the challenge of measuring enzyme activity in whole cell systems?

Measuring NADH-quinone oxidoreductase activity in intact mycobacterial cells presents several challenges, including membrane impermeability to NADH and difficulty distinguishing between multiple NADH-oxidizing enzymes. Researchers can employ several strategies to address these limitations:

  • Membrane permeabilization techniques (gentle detergent treatment, osmotic shock)

  • Cell-permeable activity probes for NADH dehydrogenase activity

  • Oxygen consumption measurements to assess respiratory chain function

  • Membrane potential-sensitive fluorescent dyes to monitor proton-motive force

  • Genetic approaches comparing wild-type, knockdown, and overexpression strains

  • Isolation of membrane fractions with enriched enzyme activity

When working with pathogenic mycobacteria like M. ulcerans, researchers must balance the need for intact cellular systems with biosafety considerations, often necessitating work in specialized containment facilities or with attenuated strains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.