Recombinant Mycobacterium ulcerans Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mycobacterium ulcerans Protease HtpX Homolog (htpX)

Recombinant Mycobacterium ulcerans Protease HtpX homolog (htpX) is a full-length (1–286 amino acids) zinc-dependent metalloprotease expressed in heterologous systems like Escherichia coli. It belongs to the M48 family of peptidases, characterized by a conserved HEXXH zinc-binding motif . This recombinant protein is engineered with an N-terminal His-tag for purification and is marketed for research applications in vaccine development, immunology, and enzymatic studies .

Diagnostic and Vaccine Development

  • Immunogenicity Studies: HtpX may serve as a candidate antigen for serological tests or subunit vaccines, though its immunogenicity in M. ulcerans remains unexplored .

  • Enzymatic Studies: Used to model M48 metalloprotease activity, particularly in membrane protein turnover .

ApplicationMethodPurpose
Protease AssaysCasein hydrolysis, zymographyCharacterize zinc-dependent catalytic activity
Structural BiologyX-ray crystallography (inferred from E. coli HtpX studies )Determine substrate-binding motifs
ImmunologyELISA, Western blottingAssess antibody responses in Buruli ulcer models

Challenges and Limitations

  • Functional Ambiguity: No direct evidence links M. ulcerans HtpX to pathogenicity or survival in hosts.

  • Expression Challenges: Recombinant HtpX requires refolding from inclusion bodies, complicating large-scale production .

  • Strain Variability: Classical M. ulcerans lineages may lack functional htpX due to genomic deletions .

Comparative Analysis with Homologs

FeatureM. ulcerans HtpXE. coli HtpX
LocalizationMembrane-associatedMembrane-bound
ActivityZinc-dependent (inferred)Zinc-dependent (confirmed)
SubstratesHypothetical (e.g., SecY analogs)Casein, SecY, self-cleavage
ThermostabilityNot reportedActive at 37–50°C

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your needs accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; MUL_0665; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Mycobacterium ulcerans (strain Agy99)
Target Names
htpX
Target Protein Sequence
MTWHPHANRLKTFLLLVGMSAMIVFFGALFGRTALILAVLFAVGMNVYVYFNSDKLALRA MHAQPVSELQAPAMYRIVRELAASAHQPMPRLYISDTAAPNAFATGRNPRNAAVCCTTGI LALLNERELRAVLGHELSHVYNRDILISCIAGALASVITALANMAMWAGMFGGKRDGQNP FALLLVSLLGPIAATVVRMAVSRSREYQADESGAVLTGDPLALASALRKISGGVQLAPLP PEPQLASQAHLMIANPFRAGERIGSLFSTHPPIEDRIRRLEQMARG
Uniprot No.

Target Background

Database Links

KEGG: mul:MUL_0665

Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is HtpX protease homolog and what is its significance in Mycobacterium ulcerans?

HtpX in M. ulcerans is a membrane-bound zinc metalloprotease that belongs to the M48 family of proteases. It plays a critical role in protein quality control within the cell membrane, particularly in the degradation of misfolded or damaged membrane proteins. While specific characterization of M. ulcerans HtpX is limited, this protein contains multiple transmembrane domains and a conserved HEXXH zinc-binding motif essential for its catalytic activity. HtpX functions in coordination with other proteases in stress response pathways, making it particularly significant given M. ulcerans' genomic reduction compared to its progenitor M. marinum .

How does M. ulcerans HtpX differ from homologs in other mycobacterial species?

M. ulcerans HtpX likely shows evolutionary adaptations similar to other proteins that have diverged during the adaptation of M. ulcerans from its M. marinum progenitor. The genomic analyses of M. ulcerans suggest that various proteins have undergone functional disruption through several mechanisms including deletions, insertions, and point mutations . Comparative sequence analysis would likely reveal conservation of catalytic residues but variations in substrate-binding regions, suggesting potential differences in substrate specificity. Unlike immunogenic proteins such as ESAT-6, CFP-10, and HspX that have been lost in the classical lineage of M. ulcerans, HtpX is likely conserved due to its essential role in protein quality control .

What is known about the genomic context and expression patterns of htpX in M. ulcerans?

The htpX gene in M. ulcerans is typically located in proximity to genes involved in membrane protein synthesis, folding, and degradation pathways. Its expression is likely upregulated during conditions that induce protein misfolding or membrane stress, such as heat shock, oxidative stress, and exposure to antimicrobial compounds. In M. ulcerans, which has adapted to specific environmental niches and acquired a plasmid encoding the cytotoxic macrolide mycolactone, HtpX expression may be uniquely regulated to accommodate the bacterium's specialized lifestyle and stress conditions encountered during infection and environmental persistence .

What role might HtpX play in M. ulcerans pathogenesis and Buruli ulcer development?

HtpX likely contributes to M. ulcerans pathogenesis through several mechanisms:

  • Stress adaptation: HtpX-mediated protein quality control enables M. ulcerans to survive within the changing environment of infected tissues by maintaining membrane protein homeostasis.

  • Immune evasion: By removing damaged membrane proteins, HtpX may contribute to reducing immunogenic epitope presentation, potentially contributing to the immune evasion strategy observed in M. ulcerans through the loss of other immunogenic proteins .

  • Mycolactone compatibility: HtpX may play a role in adapting the membrane proteome to accommodate the effects of mycolactone, the primary virulence factor of M. ulcerans.

  • Adaptation to hypoxic environments: In the necrotic tissue characteristic of Buruli ulcer, HtpX may facilitate adaptation to low-oxygen conditions by remodeling the membrane proteome.

The acquisition of mycolactone and loss of immunogenic proteins in M. ulcerans suggests selective pressure for immune evasion, and HtpX may participate in this adapted pathogenicity strategy .

How do genetic variations in htpX across M. ulcerans lineages affect protein function?

Genetic variations in htpX across M. ulcerans lineages likely reflect the distinct evolutionary trajectories of the classical versus ancestral lineages. Similar to patterns observed with other proteins in M. ulcerans, strains from the same geographical area may contain identical gene sequences, while those from different regions show sequence variations . These variations may include:

  • Single nucleotide polymorphisms affecting substrate specificity but preserving catalytic function

  • Alterations in regulatory regions affecting expression patterns

  • Variations in transmembrane domains affecting membrane localization and topology

Research on other M. ulcerans proteins has shown that the classical lineage often displays genomic reduction and loss of certain protein functions compared to the ancestral lineage, which remains more similar to M. marinum . Similar patterns might be expected for htpX, though perhaps with greater conservation due to its important housekeeping function.

What structural features of M. ulcerans HtpX are critical for its protease function?

The critical structural features of M. ulcerans HtpX essential for its protease function include:

Structural FeatureFunctionConservation
HEXXH zinc-binding motifCoordinates zinc ion essential for peptide bond hydrolysisHighly conserved across species
Transmembrane domains (4-6)Anchor protein in membrane and position catalytic siteVariable regions may affect substrate access
PDZ-like domainInvolved in substrate recognition and bindingModerate conservation with species-specific variations
Flexible linker regionsConnect transmembrane and catalytic domainsVariable, affecting conformational dynamics
Oligomerization interfacesAllow formation of proteolytic complexesModerately conserved
Conserved glycine residuesCreate flexible points in transmembrane segmentsHighly conserved at specific positions

The integration of these structural elements enables HtpX to function effectively as a membrane-embedded protease involved in protein quality control. Mutations in the zinc-binding motif would completely abolish catalytic activity, while variations in other regions would more subtly affect substrate specificity and regulation.

What expression systems are optimal for producing recombinant M. ulcerans HtpX?

Optimal expression systems for producing recombinant M. ulcerans HtpX must address the challenges inherent to membrane protein expression:

  • E. coli-based systems:

    • C41(DE3) or C43(DE3) strains: Specifically evolved for membrane protein expression

    • pBAD vectors: Allow fine-tuned expression control through arabinose concentration adjustment

    • Fusion partners: N-terminal MBP, TrxA, or SUMO tags improve folding and solubility

    • Expression at reduced temperatures (16-25°C) to minimize aggregation

  • Mycobacterial expression systems:

    • M. smegmatis mc²155: Provides a native-like membrane environment

    • Acetamide-inducible promoters: Allow controlled expression

    • Complementation of HtpX-deficient strains: Enables functional studies

  • Cell-free expression systems:

    • CFPS with nanodisc incorporation: Allows direct integration into membrane mimetics

    • Supplementation with chaperones and zinc: Improves folding and activity

When designing an expression strategy, researchers should consider the specific experimental goals and downstream applications, as each system offers different advantages for structural studies versus functional characterization.

What purification challenges are specific to M. ulcerans HtpX and how can they be overcome?

Purification of active M. ulcerans HtpX presents several challenges that can be addressed through specific strategies:

  • Membrane extraction: Screen detergents (DDM, LMNG, GDN) at concentrations just above critical micelle concentration; use detergent stability assays to determine optimal conditions.

  • Maintaining zinc coordination: Include 10-50 μM ZnCl₂ in all buffers; avoid chelating agents like EDTA; use HEPES or MOPS instead of Tris buffers.

  • Preventing aggregation: Add glycerol (10-20%), specific lipids (0.01-0.05% POPG), and low concentrations of secondary detergents (0.01% CHAPS).

  • Low expression yields: Use tandem purification tags (His₈-MBP or His₆-SUMO); optimize tag position based on topology prediction.

  • Proteolytic auto-degradation: Use reversible metalloprotease inhibitors during initial purification steps; remove before activity assays.

The selection of appropriate conditions must be empirically determined for M. ulcerans HtpX specifically, as membrane protein behavior can vary significantly even between closely related proteins.

How can researchers effectively measure the proteolytic activity of M. ulcerans HtpX?

Effective measurement of M. ulcerans HtpX proteolytic activity requires specialized assays:

  • Fluorogenic peptide assays:

    • FRET-based substrates containing sequences derived from predicted HtpX cleavage sites

    • Internally quenched fluorescent peptides that increase fluorescence upon cleavage

    • Quantitative measurement using standard curves with known proteases

  • Membrane protein substrate degradation:

    • In vitro reconstitution with known substrate membrane proteins labeled with fluorescent tags

    • Time-course analysis of substrate degradation using SDS-PAGE or western blotting

    • Mass spectrometry to identify specific cleavage sites

  • Activity validation approaches:

    • Zinc-dependency confirmation through chelation studies and site-directed mutagenesis

    • pH and temperature profiling to establish optimal conditions

    • Inhibitor studies to confirm metalloprotease mechanism

When establishing these assays, researchers should include appropriate controls, including catalytically inactive mutants (H→A mutations in HEXXH motif) and heat-inactivated enzyme preparations.

What bioinformatic approaches are most effective for identifying potential substrates of M. ulcerans HtpX?

Multiple bioinformatic approaches can be integrated to identify potential M. ulcerans HtpX substrates:

  • Sequence-based prediction:

    • Motif analysis based on known HtpX cleavage sites from homologous systems

    • Machine learning algorithms trained on validated protease substrates

    • Analysis of amino acid composition in transmembrane segments of membrane proteins

  • Structural prediction:

    • Identification of exposed regions in predicted membrane protein structures

    • Molecular docking simulations between HtpX models and candidate substrates

    • Assessment of accessibility of potential cleavage sites within the membrane

  • Evolutionary approaches:

    • Conservation analysis of potential substrates across mycobacterial species

    • Co-evolution patterns between HtpX and putative substrates

    • Comparative genomics focusing on membrane proteins unique to M. ulcerans

  • Integrative scoring:

    • Development of composite scores combining multiple predictive features

    • Prioritization of candidates based on weighted criteria

    • Confidence ranking to guide experimental validation

How can contradictory findings about M. ulcerans HtpX function be reconciled?

Contradictory findings about M. ulcerans HtpX function can be reconciled through systematic analysis:

  • Strain variation analysis:

    • Different M. ulcerans isolates may contain sequence variations affecting HtpX function

    • Consideration of evolutionary lineages (classical vs. ancestral) as seen with other M. ulcerans proteins

    • Genomic sequencing and comparison of htpX loci across isolates used in different studies

  • Methodological harmonization:

    • Standardization of recombinant protein production protocols across laboratories

    • Consensus on appropriate activity assays and experimental conditions

    • Development of reference materials and controls

  • Context-dependent function evaluation:

    • Systematic testing across environmental conditions (pH, temperature, ionic strength)

    • Analysis of co-factors or interacting partners that may modify activity

    • Investigation of substrate-specific effects that may explain apparent contradictions

This approach recognizes that contradictions often reflect biological complexity rather than experimental error, and aims to develop a more nuanced understanding of HtpX function that accommodates apparently contradictory results within a coherent mechanistic framework.

How does disruption of HtpX affect the broader M. ulcerans proteome?

Disruption of HtpX creates widespread effects on the M. ulcerans proteome that can be detected through comparative proteomics:

  • Direct substrate accumulation:

    • Increased levels of damaged or misfolded membrane proteins normally degraded by HtpX

    • Altered turnover rates of regulatory membrane proteins affecting signaling pathways

  • Compensatory protease responses:

    • Upregulation of alternative proteases attempting to compensate for HtpX absence

    • Modified activity of other quality control systems (chaperones, folding factors)

  • Membrane proteome remodeling:

    • Altered membrane protein composition affecting permeability and transport functions

    • Modified lipid-protein interactions affecting membrane domain organization

  • Stress response pathway activation:

    • Induction of heat shock proteins and other stress-responsive factors

    • Altered translation rates to reduce production of proteins that cannot be properly maintained

The pattern of these changes would differ between standard laboratory conditions and stress conditions (heat, oxidative stress, antibiotic exposure), revealing the context-dependent roles of HtpX in maintaining proteostasis.

How does the evolutionary history of HtpX compare with other M. ulcerans proteins?

The evolutionary history of HtpX likely differs from immunogenic proteins that have been lost or disrupted in M. ulcerans. While immunogenic proteins like ESAT-6, CFP-10, and HspX have undergone various disruptions including complete deletion, conversion to pseudogenes, and frameshift mutations across different M. ulcerans lineages , essential housekeeping proteins like HtpX typically show greater conservation.

Research has shown that many M. ulcerans proteins follow distinctive evolutionary patterns:

  • Proteins involved in immune recognition: Often completely deleted or disrupted in the classical lineage but partially retained in the ancestral lineage

  • Metabolic proteins: Generally conserved but with reduced redundancy compared to M. marinum

  • Virulence-associated proteins: Sometimes replaced by alternative mechanisms (e.g., mycolactone production)

The selective pressures that drove the loss of immunogenic proteins in M. ulcerans appear to represent adaptation to environments screened by immunological defense mechanisms . HtpX, as a housekeeping protein involved in proteostasis, would likely be under different selective pressures favoring functional conservation with potential modifications to substrate specificity.

How do experimental approaches for studying HtpX differ between M. ulcerans and other mycobacterial species?

Experimental approaches for studying HtpX differ between M. ulcerans and other mycobacterial species due to several factors:

Experimental AspectM. ulcerans-specific ConsiderationsApproaches in Other Mycobacteria
Growth conditionsSlow growth (6-8 weeks), lower temperature optimum (30-32°C), mycolactone productionFaster growth for M. smegmatis, higher temperature optimum for M. tuberculosis
Genetic manipulationMore challenging transformation, specialized vectors requiredWell-established genetic systems for M. tuberculosis and M. smegmatis
Biosafety requirementsBSL-3 for most work with viable bacteriaBSL-2 for M. smegmatis, BSL-3 for M. tuberculosis
Model systemsLimited animal models (mouse footpad, guinea pig)Diverse models for TB (mice, guinea pigs, rabbits, non-human primates)
Protein expressionMay require specialized detergents to accommodate mycolactone-modified membranesStandard membrane protein approaches often sufficient

Researchers studying M. ulcerans HtpX must adapt protocols developed for other mycobacteria, accounting for these differences while leveraging the greater body of knowledge available from studies of HtpX in better-characterized mycobacterial species.

What emerging technologies could advance our understanding of M. ulcerans HtpX?

Several emerging technologies hold promise for advancing our understanding of M. ulcerans HtpX:

  • Cryo-electron microscopy: Enable determination of membrane-embedded HtpX structure at near-atomic resolution, providing insights into substrate binding and catalytic mechanism.

  • AlphaFold and related AI structure prediction: Generate increasingly accurate structural models of HtpX and its interactions with substrates, guiding experimental design.

  • Advanced proteomics:

    • Thermal proteome profiling to identify HtpX substrates and interacting partners

    • Crosslinking mass spectrometry to capture transient enzyme-substrate complexes

    • Targeted degradomics to identify cleavage sites with single-amino acid resolution

  • Microfluidic approaches:

    • Single-cell analysis of HtpX activity in M. ulcerans populations

    • Droplet-based high-throughput screening for inhibitors or substrates

  • CRISPR interference in mycobacteria: Enable precise modulation of HtpX expression levels to study dose-dependent effects.

  • Organoid and 3D tissue culture models: Provide more physiologically relevant environments to study HtpX function during host-pathogen interactions.

These technologies, used in combination, could overcome current limitations in studying this challenging membrane protease in a slow-growing pathogen.

What are the most promising therapeutic applications targeting M. ulcerans HtpX?

While HtpX has not been extensively explored as a therapeutic target, several promising applications warrant investigation:

  • Small molecule inhibitors:

    • Zinc-chelating compounds with specificity for the HtpX active site

    • Allosteric inhibitors targeting regulatory domains

    • Compounds disrupting oligomerization or membrane association

  • Combination therapies:

    • HtpX inhibitors with existing antibiotics to enhance bacterial clearance

    • Targeting multiple proteases simultaneously (HtpX, FtsH) to overwhelm proteostasis

    • Inhibition of HtpX combined with induction of protein misfolding

  • Diagnostic applications:

    • Detection of HtpX activity as a marker of viable M. ulcerans

    • Monitoring of HtpX inhibition as a pharmacodynamic marker in drug development

    • Distinguishing M. ulcerans strains based on HtpX sequence or expression levels

  • Vaccine development:

    • HtpX epitopes as potential components of subunit vaccines

    • Attenuated strains with modified HtpX activity

Given the importance of protein quality control for bacterial survival under stress conditions, targeting HtpX could represent a novel approach to treating Buruli ulcer, particularly for recalcitrant or relapsing cases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.