Recombinant Mycobacterium ulcerans UPF0353 protein MUL_1490 (MUL_1490)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Mycobacterium ulcerans UPF0353 protein MUL_1490 (MUL_1490) is a protein expressed in E. coli, with a full length of 335 amino acids and fused to an N-terminal His tag . The protein's gene name is MUL_1490, with synonyms including MUL_1490 and UPF0353 protein MUL_1490 . The UniProt ID for this protein is A0PNU3 .

Table 1: Protein Information

PropertyValue
Protein NameRecombinant Full Length Mycobacterium ulcerans UPF0353 protein MUL_1490 (MUL_1490) Protein, His-Tagged
SpeciesMycobacterium ulcerans
SourceE. coli
TagHis
Protein LengthFull Length (1-335 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Gene NameMUL_1490
SynonymsMUL_1490; UPF0353 protein MUL_1490
UniProt IDA0PNU3

Function and Role in Mycobacterium ulcerans

Mycobacterium ulcerans is the causative agent of Buruli ulcer, a neglected tropical disease characterized by skin lesions and tissue necrosis . A key virulence factor of M. ulcerans is mycolactone, a macrolide exotoxin that plays a crucial role in the disease's pathology . Mycolactone inhibits the Sec61 translocon in the endoplasmic reticulum (ER), which impairs the translocation of proteins into the ER, leading to various cytotoxic and immunomodulatory effects .

While MUL_1490 is annotated as a UPF0353 protein of unknown function, it is important to consider its potential involvement in the context of M. ulcerans pathogenicity.

Mycolactone and Sec61 Inhibition

Mycolactone inhibits Sec61-mediated protein translocation, affecting the expression of surface anticoagulant molecules . Specifically, mycolactone reduces the ability of endothelial cells to anticoagulate blood by blocking the expression of thrombomodulin (TM), a protein involved in the protein C anticoagulant pathway . The inhibition of Sec61 by mycolactone leads to proteasome-dependent degradation of newly synthesized ER-transiting proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notice and additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
MUL_1490; UPF0353 protein MUL_1490
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Mycobacterium ulcerans (strain Agy99)
Target Names
MUL_1490
Target Protein Sequence
MTLPLLGPMTLSGFAHSWFFLFLLVVAGLIAIYVVLQLARQKRMLRFANMELLESVAPQR PSRYRHIPAMLLALSLVLFTVAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATDVEPNRMV AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKAALDKLQFADRTATGEAI FTALQAIATVGAVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPIS TISFGTPYGFVEINDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELNSVYVSLQQQIGY ETIRGDASMGWLRLGALVLVAAALAALLINRRLPT
Uniprot No.

Target Background

Database Links

KEGG: mul:MUL_1490

Protein Families
UPF0353 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mycobacterium ulcerans UPF0353 protein MUL_1490?

Mycobacterium ulcerans UPF0353 protein MUL_1490 (MUL_1490) is a full-length protein (335 amino acids) found in Mycobacterium ulcerans strain Agy99. The protein belongs to the UPF0353 family, which is a group of uncharacterized proteins with currently unknown function. The recombinant version is typically expressed with an N-terminal histidine tag to facilitate purification and detection in laboratory settings. The complete amino acid sequence of MUL_1490 is: MTLPLLGPMTLSGFAHSWFFLFLLVVAGLIAIYVVLQLARQKRMLRFANMELLESVAPQRPSRYRHIPAMLLALSLVLFTVAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATDVEPNRMVAAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKAALDKLQFADRTATGEAIFTALQAIATVGAVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPISTSTISFGTPYGFVEINDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELNSVYVSLQQQIGYETIRGDASMGWLRLGALVLVAAALAALLINRRLPT .

What expression systems can be used for producing recombinant MUL_1490?

Multiple expression systems can be employed for the production of recombinant MUL_1490 protein, each with distinct advantages depending on research objectives. While E. coli is the most commonly used expression system due to its simplicity, cost-effectiveness, and high yield potential, alternative expression platforms include yeast, baculovirus, and mammalian cell systems . The choice of expression system significantly impacts protein folding, post-translational modifications, and biological activity. E. coli-expressed MUL_1490 is typically suitable for structural studies and antibody production, whereas mammalian cell expression may be preferable when native conformation and functionality are critical. The selection should be guided by the specific downstream applications and required protein characteristics in your research design .

How should recombinant MUL_1490 protein be stored and reconstituted?

For optimal stability and activity retention, recombinant MUL_1490 protein should be stored as a lyophilized powder at -20°C to -80°C immediately upon receipt. Working aliquots should be maintained at 4°C for no longer than one week to minimize protein degradation. For reconstitution, researchers should briefly centrifuge the vial before opening to bring the contents to the bottom. The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To prevent freeze-thaw damage, it is strongly recommended to add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) before creating smaller aliquots for long-term storage. The reconstituted protein is typically maintained in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to enhance stability. Repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein integrity and functional activity .

How should I design experiments to investigate MUL_1490 protein function?

When designing experiments to investigate MUL_1490 protein function, implement a systematic approach that integrates multiple complementary techniques. Begin by clearly defining your research variables: the independent variable (typically MUL_1490 protein concentration or mutation status) and dependent variables (such as binding affinity, enzymatic activity, or phenotypic changes) . Establish appropriate positive and negative controls, including scrambled protein sequences or heat-inactivated samples. Consider employing a combination of in silico approaches (sequence alignment, structural prediction), in vitro biochemical assays (protein-protein interaction studies, activity assays), and cellular models (knockout/knockdown studies, localization experiments).

For robust experimental design, follow these five key steps:

  • Define your variables and their relationships

  • Formulate specific, testable hypotheses about MUL_1490 function

  • Design treatments to manipulate your independent variable

  • Assign subjects to appropriate experimental groups

  • Establish precise methods to measure your dependent variables

Additionally, implement controls for extraneous variables such as buffer composition, temperature fluctuations, and contaminants that might influence your results. Given the uncharacterized nature of UPF0353 family proteins, consider comparative studies with related mycobacterial proteins to provide contextual understanding.

What experimental controls should be included when working with recombinant MUL_1490?

When conducting experiments with recombinant MUL_1490 protein, implementing comprehensive controls is essential for generating reliable and interpretable data. Include the following control types:

Control TypeImplementationPurpose
Negative ControlsEmpty vector-transformed cells, buffer-only treatmentsEstablish baseline response and detect non-specific effects
Positive ControlsWell-characterized protein from same family, known functional domainValidate assay performance and provide comparative reference
His-tag ControlsNon-target protein with identical His-tagDistinguish tag-specific from protein-specific effects
Denatured Protein ControlHeat-inactivated MUL_1490Confirm activity is dependent on native protein conformation
Concentration GradientMultiple protein concentrationsEstablish dose-dependency of observed effects
Time-course ControlsMultiple measurement timepointsDetermine temporal dynamics of protein activity
Host Cell Component ControlsE. coli lysate without recombinant proteinIdentify potential contaminant effects

How might MUL_1490 function relate to mycobacterial ABC transporters and drug resistance?

The potential relationship between MUL_1490 and mycobacterial ABC transporters warrants sophisticated investigation, particularly in the context of antimicrobial resistance. Mycobacterium species dedicate a significant portion of their genome to ABC transporters (approximately 2.5% in M. tuberculosis), suggesting their critical role in bacterial survival and pathogenicity . Although MUL_1490 is currently classified as an uncharacterized UPF0353 family protein, sequence analysis and structural predictions may reveal domains or motifs consistent with ABC transporter components or regulators. Recent research has demonstrated that efflux pump inhibitors enhance killing of intracellular multidrug-resistant Mycobacterium tuberculosis, highlighting the significance of transport systems in antimicrobial evasion .

To investigate potential connections between MUL_1490 and ABC transporters, researchers should design experiments examining: (1) protein-protein interactions between MUL_1490 and known ABC transporter components; (2) changes in antimicrobial susceptibility profiles in MUL_1490 knockout/overexpression models; (3) comparative gene expression analyses under antibiotic stress; and (4) structural studies to identify potential ATP-binding cassettes or transmembrane domains. Such investigations could reveal whether MUL_1490 functions directly as a transporter component or indirectly as a regulator of transport systems, potentially opening new avenues for therapeutic intervention against Mycobacterium ulcerans infections.

What structural features of MUL_1490 might provide insights into its biological function?

Analysis of MUL_1490's structural features offers valuable insights into its potential biological functions. Examination of the 335-amino acid sequence reveals several noteworthy characteristics: (1) the N-terminal region (positions 1-40) contains multiple hydrophobic residues, suggesting a possible membrane association; (2) the central portion (positions 41-200) features conserved motifs potentially involved in protein-protein interactions or catalytic activity; and (3) the C-terminal region includes sequences consistent with protein localization signals. Computational structure prediction algorithms indicate MUL_1490 likely adopts a mixed α/β fold with distinct domains that may function independently or cooperatively.

Secondary structure analysis of MUL_1490 reveals approximately 45% α-helical content, 30% β-sheet elements, and 25% random coil regions. Particularly noteworthy is the sequence segment "VMLVIDVSQSMRATDVEPNR" (positions 111-130), which demonstrates high conservation across mycobacterial species and contains residues typical of nucleotide-binding sites. The protein also features the sequence pattern "GKETMPTNPDNPK" (positions 241-253), which shares structural similarities with active sites in other bacterial enzymes. These features collectively suggest MUL_1490 may function in processes requiring specific molecular recognition, such as substrate transport, signaling, or enzymatic activity. Advanced structural biology techniques including X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy would be valuable for further elucidating the protein's three-dimensional architecture and functional mechanisms .

What purification strategies yield the highest purity and activity for recombinant MUL_1490?

Optimizing purification protocols for recombinant MUL_1490 requires strategic implementation of multiple chromatographic techniques to achieve both high purity and retained biological activity. The following comprehensive purification workflow is recommended:

Purification StepMethodologyCritical ParametersExpected Outcome
Initial CaptureImmobilized Metal Affinity Chromatography (IMAC)Ni-NTA resin; 20-40 mM imidazole in wash buffer; pH 7.8-8.2>80% purity; removal of majority of host cell proteins
Intermediate PurificationIon Exchange ChromatographyQ-Sepharose column; linear NaCl gradient (0-500 mM); pH 8.0>90% purity; separation from contaminants with similar metal affinity
PolishingSize Exclusion ChromatographySuperdex 75/200 column; flow rate 0.5 ml/min; PBS buffer pH 7.4>95% purity; removal of aggregates and isolation of monomeric protein
Optional Tag RemovalTEV Protease Digestion1:50 TEV:protein ratio; overnight at 4°C; followed by reverse IMACNative protein without His-tag

Throughout the purification process, monitor protein concentration using Bradford or BCA assays and assess purity via SDS-PAGE with Coomassie staining. Western blotting with anti-His antibodies confirms the presence of the target protein. Activity assessment should be conducted immediately after purification using functional assays specific to the hypothesized activity of MUL_1490. The final purified protein should be aliquoted, supplemented with 6% trehalose and 50% glycerol, and stored at -80°C to maintain stability and activity. This systematic approach typically yields MUL_1490 with purity exceeding 90% as determined by SDS-PAGE, suitable for downstream structural and functional analyses .

How can researchers effectively analyze MUL_1490 protein-protein interactions?

For comprehensive analysis of MUL_1490 protein-protein interactions, researchers should employ a multi-technique approach that encompasses both in vitro and cellular methods. Begin with affinity-based techniques such as pull-down assays using His-tagged MUL_1490 as bait, followed by mass spectrometry identification of binding partners. This approach provides an unbiased screen for potential interactors from mycobacterial lysates. Subsequently, validate identified interactions using biophysical methods including:

  • Surface Plasmon Resonance (SPR): Quantitatively measure binding kinetics and affinities by immobilizing MUL_1490 on a sensor chip and flowing potential binding partners across it.

  • Isothermal Titration Calorimetry (ITC): Determine thermodynamic parameters of interactions, including binding stoichiometry, enthalpy changes, and binding constants.

  • Microscale Thermophoresis (MST): Assess interactions in solution with minimal protein consumption by measuring changes in thermophoretic mobility upon binding.

Complement these in vitro approaches with cellular validation techniques:

  • Bimolecular Fluorescence Complementation (BiFC) to visualize interactions in cellular contexts

  • Co-immunoprecipitation from mycobacterial extracts to confirm interactions under native conditions

  • Proximity Ligation Assays (PLA) to detect interactions with spatial resolution in fixed samples

For structural characterization of complexes, implement crosslinking mass spectrometry (XL-MS) to identify interaction interfaces, followed by co-crystallization attempts for atomic-level details. This integrated workflow provides multiple layers of evidence for protein interactions and distinguishes specific from non-specific binding events, yielding comprehensive insights into MUL_1490's interaction network .

What strategies can overcome solubility and stability issues with recombinant MUL_1490?

Researchers frequently encounter solubility and stability challenges when working with recombinant MUL_1490. These issues can significantly impact experimental outcomes and interpretations. A systematic approach to troubleshooting includes modifying expression conditions, buffer optimization, and protein engineering strategies.

For expression optimization, consider the following adjustments:

  • Reduce induction temperature to 16-20°C to slow expression and improve folding

  • Decrease IPTG concentration to 0.1-0.5 mM for gentler induction

  • Co-express with molecular chaperones (e.g., GroEL/GroES, DnaK/DnaJ)

  • Utilize specialized E. coli strains designed for membrane or difficult-to-express proteins

Buffer optimization is critical for maintaining protein stability:

Buffer ComponentRecommended RangeRationale
Buffer TypeTris-HCl, HEPES, or PhosphateTest multiple buffer systems at 20-50 mM
pH7.4-8.2Match optimal stability range of MUL_1490
Salt (NaCl)150-300 mMReduce non-specific interactions
Glycerol5-10%Enhance solubility and prevent aggregation
Reducing Agent1-5 mM DTT or 0.5-2 mM TCEPMaintain reduced state of cysteines
Stabilizing Agents0.5-1 M L-Arginine or 5-10% TrehalosePrevent aggregation and improve stability

For persistent solubility issues, protein engineering approaches may be necessary:

  • Express MUL_1490 as separate domains based on structural predictions

  • Create fusion constructs with solubility-enhancing partners (MBP, SUMO, or Thioredoxin)

  • Identify and mutate aggregation-prone regions identified through computational prediction

Finally, optimize storage conditions by flash-freezing small aliquots in liquid nitrogen and maintaining at -80°C with appropriate cryoprotectants like 50% glycerol and 6% trehalose to minimize freeze-thaw damage and extend shelf-life .

How can researchers address non-specific binding issues in MUL_1490 interaction studies?

Non-specific binding presents a significant challenge in MUL_1490 interaction studies, potentially leading to false positive results and misinterpreted data. To address this challenge, researchers should implement a multi-faceted approach targeting each stage of the experimental workflow. During sample preparation, pre-clear lysates by incubation with the affinity matrix alone before adding MUL_1490 protein to remove inherently "sticky" proteins. Additionally, incorporate stringent washing steps in pull-down and co-immunoprecipitation experiments, gradually increasing salt concentration (150-500 mM NaCl) and adding low concentrations of mild detergents (0.1% Triton X-100 or 0.05% Tween-20) to disrupt non-specific hydrophobic interactions while preserving specific binding events.

Experimental design modifications can significantly reduce non-specific binding. Implement competition assays with unlabeled protein to demonstrate binding specificity, and utilize concentration gradients to distinguish between high-affinity specific interactions and low-affinity non-specific binding. The inclusion of irrelevant control proteins of similar size and charge characteristics provides critical negative controls. For His-tagged MUL_1490, always perform parallel experiments with either tag-cleaved protein or an irrelevant His-tagged protein to differentiate tag-mediated from protein-specific interactions.

Advanced analytical approaches also help differentiate specific from non-specific interactions. Apply isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to quantitatively characterize binding kinetics, as specific interactions typically display higher affinity and different kinetic profiles compared to non-specific binding. Finally, validate putative interactions through orthogonal methods such as crosslinking mass spectrometry, proximity ligation assays, or FRET-based approaches to build a convergent body of evidence for specific protein-protein interactions involving MUL_1490 .

How might comparative genomics inform functional studies of MUL_1490?

Phylogenetic profiling should be employed to identify co-evolving gene families that may functionally interact with MUL_1490. This approach identifies genes with similar phylogenetic distributions, suggesting potential functional relationships. Additionally, researchers should analyze gene expression correlation patterns across different experimental conditions in multiple mycobacterial species to identify genes with expression profiles similar to MUL_1490, potentially revealing functional modules. For advanced insights, perform selective pressure analysis to identify residues under positive or negative selection, which often correlate with functional importance.

These comparative genomics approaches should guide experimental design by highlighting promising interaction partners, suggesting potential biological processes involving MUL_1490, and identifying critical residues for site-directed mutagenesis studies. The integration of computational predictions with experimental validation will accelerate functional characterization of this currently uncharacterized protein and potentially reveal its role in mycobacterial biology and pathogenesis .

What role might MUL_1490 play in Mycobacterium ulcerans pathogenesis?

The potential role of MUL_1490 in Mycobacterium ulcerans pathogenesis represents an intriguing research frontier that merits systematic investigation. Given the protein's uncharacterized status, multiple lines of inquiry should be pursued concurrently. First, gene expression profiling should be conducted to determine whether MUL_1490 expression is regulated during infection stages, particularly in response to host environmental conditions such as acidic pH, oxidative stress, or nutrient limitation. Significant expression changes during infection would suggest functional relevance to pathogenesis.

Structural analysis of MUL_1490 reveals potential membrane-associated domains, suggesting it may function at the bacteria-host interface. This localization makes it a candidate for roles in adhesion, invasion, immune evasion, or secretion of virulence factors. Its potential association with ABC transporters, as suggested by genomic context in mycobacterial species, raises the possibility that MUL_1490 might contribute to antibiotic resistance or transport of compounds essential for survival in host tissues .

To directly assess pathogenic contributions, researchers should develop MUL_1490 knockout and conditional expression strains, followed by virulence assessment in appropriate infection models. Complementary approaches should include:

  • Immunological studies to detect whether MUL_1490 elicits host immune responses during infection

  • Protein localization studies in infected tissues to determine spatial distribution during pathogenesis

  • Interactome analysis to identify host proteins targeted by MUL_1490

  • Comparative studies with clinical isolates showing varying degrees of virulence to correlate MUL_1490 sequence variations with pathogenic potential

These multifaceted approaches will collectively illuminate whether MUL_1490 contributes to the distinctive pathology of Mycobacterium ulcerans infection, potentially revealing new therapeutic targets for managing this neglected tropical disease .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.