Recombinant Mycobacterium vanbaalenii ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your process.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; Mvan_4332; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1)
Target Names
atpF
Target Protein Sequence
MGELTTSIVAAEEGGGTSNFLIPNGTFFVVLLIFLIVLGVIAKWVVPPVSKVLAEREAML AKTAADNRKSAEQVAAAQADYDKTMADARGEASSIRDEARVAGRQVVDEKRAVASGEVAE TVKSADQQLSQQGSAAQSELQSSVDGLSATLASRILGVDVNSGGSR
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, which houses the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • How is recombinant M. vanbaalenii ATP synthase subunit b (atpF) expressed and purified for research applications?

    According to available data, recombinant M. vanbaalenii ATP synthase subunit b (atpF) is typically expressed as a fusion protein with an N-terminal His-tag in Escherichia coli expression systems . The recommended expression and purification protocol includes:

    StepMethodDetails
    Expression systemE. coliUsing full-length protein (amino acids 1-166) with N-terminal His-tag
    Cell lysisSonication or pressure-based methodsIn buffer containing protease inhibitors
    Initial purificationImmobilized metal affinity chromatography (IMAC)Using Ni-NTA resin with increasing imidazole concentrations
    Secondary purificationSize exclusion chromatographyTo remove aggregates and improve homogeneity
    Quality controlSDS-PAGE and Western blottingTo verify purity and identity
    StorageTris-based buffer with 50% glycerolStore at -20°C, or -80°C for extended storage

    Repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week .

  • What is the significance of ATP synthase in mycobacterial energy metabolism and virulence?

    ATP synthase plays a critical role in mycobacterial bioenergetics and has several unique features that distinguish it from other bacterial homologs:

    The mycobacterial F1F0-ATP synthase complex is responsible for synthesizing ATP using the proton motive force (PMF) generated across the cytoplasmic membrane . Unlike many other bacteria, mycobacterial ATP synthase exhibits latent ATPase activity, which prevents wasteful ATP hydrolysis and alteration of the PMF that would be lethal to mycobacteria .

    Recent studies have identified ATP synthase as being induced during polycyclic aromatic hydrocarbon metabolism in M. vanbaalenii PYR-1, suggesting its involvement in adaptation to various growth conditions . This connection to metabolic versatility may contribute to the organism's survival in diverse environments.

    Furthermore, the essentiality of ATP synthase in mycobacterial species makes it an important drug target. The diarylquinoline bedaquiline, which specifically inhibits mycobacterial ATP synthase, is used to treat drug-resistant tuberculosis . Understanding the structure and function of all ATP synthase components, including subunit b, is crucial for developing new antimicrobial strategies.

  • How do the structural features of mycobacterial ATP synthase differ from those of other bacterial species?

    Mycobacterial ATP synthase possesses several unique structural features that distinguish it from other bacterial ATP synthases:

    • Composition: The mycobacterial F1F0-ATP synthase has a subunit composition of α3:β3:γ:δ:ε:a:b:b′:c9 .

    • C-terminal extension: The nucleotide-binding subunit α contains a 3.5-kDa C-terminal extension (αCTD) that contributes significantly to the suppression of ATPase activity .

    • Latent ATPase activity: Mycobacterial F1F0-ATP synthases are incapable of ATP-driven proton translocation due to their latent ATPase activity, which prevents wasting of ATP and alteration of the proton motive force .

    • Additional structural elements: The mycobacterial ATP synthase contains an extra 14-amino-acid γ-loop and a specialized C-terminus of subunit ε that contribute to suppressing ATPase activity .

    These structural differences are functionally significant, as they confer unique regulatory properties to the mycobacterial ATP synthase and create opportunities for selective inhibition by antimicrobial compounds .

  • What experimental applications are available for recombinant M. vanbaalenii ATP synthase subunit b (atpF)?

    Recombinant M. vanbaalenii ATP synthase subunit b (atpF) can be utilized in various experimental applications, including:

    • Structural studies: As a component for reconstituting ATP synthase complexes for X-ray crystallography or cryo-electron microscopy analyses .

    • Biochemical assays: In reconstitution experiments to study ATP synthesis and hydrolysis activities .

    • Protein-protein interaction studies: To investigate interactions with other ATP synthase subunits or potential regulatory proteins .

    • Antibody production: As an antigen for generating specific antibodies for detection and localization studies.

    • Drug screening: As part of reconstituted ATP synthase complexes to evaluate potential inhibitors .

    • Immunological research: For studying host immune responses to mycobacterial antigens, particularly in the context of vaccine development .

    These applications contribute to our understanding of ATP synthase function and can facilitate the development of new therapeutic strategies targeting mycobacterial energy metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.