Recombinant Mycobacterium vanbaalenii NADH-quinone oxidoreductase subunit K (nuoK)

What is the structural composition of Mycobacterium vanbaalenii NADH-quinone oxidoreductase subunit K?

Mycobacterium vanbaalenii NADH-quinone oxidoreductase subunit K (nuoK) is a 99-amino acid protein that functions as a critical component of the Type 1 NADH Dehydrogenase complex in the bacterial respiratory chain. The full amino acid sequence is: MSPDNYLYLSALLFTIGAAGVLLRRNAIVMFMCIELMLNAANLAFVTFSRIHGHLDGQVVAFFTMVVAACEVVIGLAIITMIFRTRRSASVDAANLLKH . This protein contains predominantly hydrophobic residues, consistent with its role as a membrane-embedded subunit of the respiratory complex. When expressed recombinantly, the protein can be produced with an N-terminal His-tag to facilitate purification without compromising functional integrity .

What is the taxonomic classification of Mycobacterium vanbaalenii and how does it relate to nuoK research?

Mycobacterium vanbaalenii belongs to the following taxonomic hierarchy:

• Domain: Bacteria

• Kingdom: Bacillati

• Phylum: Actinomycetota

• Class: Actinomycetia

• Order: Mycobacteriales

• Family: Mycobacteriaceae

• Genus: Mycobacterium

• Species: M. vanbaalenii

Understanding this classification is essential for comparative genomics studies of nuoK across related mycobacterial species. M. vanbaalenii was first isolated from petroleum-contaminated estuarine sediments and is phylogenetically related to Mycobacterium aurum and Mycobacterium vaccae based on 16S rRNA sequencing . This environmental origin and its non-pathogenic nature make it an excellent model organism for studying respiratory chain components like nuoK without the biosafety concerns associated with pathogenic mycobacteria.

What is the physiological role of NADH-quinone oxidoreductase in mycobacterial metabolism?

NADH-quinone oxidoreductase (Complex I) serves as the primary entry point for electrons into the respiratory chain in mycobacteria. This complex oxidizes NADH, transferring electrons to menaquinone while simultaneously pumping protons across the membrane, contributing to the establishment of the proton motive force necessary for ATP synthesis . The nuoK subunit, as an integral membrane component, likely participates in the proton translocation channel of the complex.

In the context of Mycobacterium vanbaalenii's remarkable metabolic versatility, particularly its ability to degrade polycyclic aromatic hydrocarbons, the respiratory chain components including nuoK play crucial roles in energy generation during both aerobic growth and adaptation to environmental stresses . The expression levels of various nuo genes, including nuoK, have been observed to change during adaptation to hypoxic conditions, suggesting their importance in metabolic flexibility .

How does nuoK expression change under varying oxygen tensions and what are the implications for mycobacterial persistence?

Research data indicates that nuoK is among the subset of Type 1 NADH Dehydrogenase subunits that show increased expression indices during oxygen depletion in the Wayne model of non-replicating persistence (NRP) . As shown in the table below, nuoK is one of only six nuo subunits (out of fourteen) that maintain elevated expression under hypoxic conditions:

This selective upregulation suggests that nuoK may have particular importance during metabolic adaptation to low-oxygen environments. The continued expression of nuoK while other respiratory components are downregulated indicates its potential role in maintaining minimal energetic requirements during dormancy or stress conditions. This finding has significant implications for understanding how mycobacteria adapt their respiratory apparatus during transitions to non-replicating states, which is particularly relevant to environmental persistence mechanisms.

What structural and functional relationships exist between nuoK and other respiratory chain components during metabolic adaptation?

The selective expression of certain nuo subunits, including nuoK, during oxygen depletion suggests a restructuring of the respiratory apparatus rather than simple downregulation . This selective expression pattern indicates that a modified or partial Complex I may function during adaptation to hypoxia.

When analyzing the respiratory chain as an integrated system, it's notable that all ATP synthase and cytochrome components maintain expression under oxygen limitation, while menaquinone synthesis genes are downregulated . This creates an interesting research question: how does nuoK function in a respiratory chain with limited menaquinone availability? One hypothesis is that the maintained expression of nuoK and other select nuo genes enables a reconfigured electron transport chain that operates at reduced capacity but sufficient to maintain the proton motive force required for ATP homeostasis and bacterial survival.

Structural biology approaches including cryo-electron microscopy would be valuable to determine whether the hypoxia-expressed nuo subunits form a distinct subcomplexes with modified functionality compared to the complete Complex I.

How might nuoK function contribute to Mycobacterium vanbaalenii's unusual ability to metabolize polycyclic aromatic hydrocarbons?

Mycobacterium vanbaalenii has remarkable metabolic capabilities, including the degradation of various polycyclic aromatic hydrocarbons such as pyrene, anthracene, fluoranthene, naphthalene, phenanthrene, and more complex compounds like 1-nitropyrene and benzopyrene . This extensive catabolic versatility requires robust energy generation systems to support the enzymatic machinery involved in breaking down these recalcitrant compounds.

The role of nuoK and the NADH-quinone oxidoreductase complex in this process may be multifaceted:

• Energy provision: The oxidation of degradation intermediates likely generates NADH that must be efficiently processed by the respiratory chain.

• Redox balance maintenance: During the oxidation of aromatic compounds, maintaining cellular redox balance is crucial, with the respiratory chain serving as a major electron sink.

• Adaptation to microaerophilic conditions: Degradation of hydrocarbons often occurs in contaminated sediments with limited oxygen availability, conditions where the modified respiratory chain involving nuoK may be particularly important.

Research investigating the correlation between nuoK expression levels and rates of specific hydrocarbon degradation would provide valuable insights into these relationships. Comparative analysis of nuoK sequence and expression between M. vanbaalenii and non-hydrocarbon-degrading mycobacteria might further elucidate any specialized adaptations of this subunit.

What are the optimal expression and purification protocols for recombinant Mycobacterium vanbaalenii nuoK?

The successful expression and purification of recombinant Mycobacterium vanbaalenii nuoK can be achieved using the following methodology:

Expression System: Escherichia coli has been demonstrated as an effective heterologous expression system for recombinant nuoK . The incorporation of an N-terminal His-tag facilitates subsequent purification while typically preserving protein functionality.

Purification Protocol:

• After expression, cells should be harvested and lysed using standard protocols appropriate for membrane proteins

• The His-tagged nuoK can be purified using nickel affinity chromatography

• Further purification can be achieved through size exclusion chromatography if higher purity is required

• The final product is typically prepared as a lyophilized powder for long-term stability

Quality Control:

• Purity assessment by SDS-PAGE (target >90% purity)

• Western blot confirmation using anti-His antibodies

• Mass spectrometry verification of protein identity

Storage Recommendations:

• Store lyophilized powder at -20°C/-80°C

• After reconstitution, working aliquots can be stored at 4°C for up to one week

• For long-term storage of reconstituted protein, addition of 5-50% glycerol (final concentration) and storage at -20°C/-80°C is recommended

• Repeated freeze-thaw cycles should be avoided

What reconstitution and handling techniques maximize nuoK stability and activity?

Proper reconstitution and handling are critical for maintaining the functional integrity of recombinant nuoK:

Reconstitution Protocol:

• Briefly centrifuge the vial containing lyophilized protein before opening

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• For optimal storage, add glycerol to a final concentration of 50%

• Prepare small working aliquots to minimize freeze-thaw cycles

Buffer Considerations:

• The protein is stable in Tris/PBS-based buffer at pH 8.0 with 6% trehalose

• For functional studies, consider buffers that mimic the native membrane environment

• Addition of appropriate detergents may be necessary to maintain solubility of this membrane protein

Activity Preservation:

• Given nuoK's role as a membrane-embedded respiratory complex subunit, its functional activity is best preserved in lipid bilayer environments or suitable detergent micelles

• For functional studies, reconstitution into proteoliposomes or nanodiscs may be necessary

What experimental approaches are most effective for studying nuoK function in the context of respiratory adaptation?

Several complementary experimental approaches can be employed to study nuoK function during respiratory adaptation:

Gene Expression Analysis:

• Quantitative PCR to measure nuoK expression under various oxygen tensions and growth conditions

• RNA sequencing to understand transcriptional co-regulation with other respiratory components

• Promoter-reporter fusions to monitor nuoK expression in real-time

Protein Interaction Studies:

• Bacterial two-hybrid systems to identify interaction partners

• Co-immunoprecipitation with other respiratory complex components

• Cross-linking mass spectrometry to map the interaction interface with other subunits

Functional Assays:

• Membrane potential measurements in wild-type versus nuoK-depleted strains

• Oxygen consumption rates under various conditions

• ATP synthesis measurements to assess the impact on energy generation

• NADH oxidation rates in membrane preparations

Structural Biology Approaches:

• Cryo-electron microscopy of the intact complex or subcomplexes

• Site-directed spin labeling and electron paramagnetic resonance spectroscopy for conformational analysis

• Computational modeling of nuoK within the complex based on homologous structures

These methodologies, applied in combination, can provide comprehensive insights into how nuoK contributes to respiratory adaptation during environmental stress conditions and metabolic shifts.

How can recombinant nuoK studies inform bioremediation strategies using Mycobacterium vanbaalenii?

Mycobacterium vanbaalenii has significant potential for bioremediation of polycyclic aromatic hydrocarbon-contaminated sites . Understanding nuoK function can inform bioremediation applications in several ways:

Energy Metabolism Optimization:
Research on nuoK and respiratory adaptation can reveal how to optimize energy generation during bioremediation processes, potentially enhancing degradation rates of pollutants. By understanding how the respiratory chain adapts to limited oxygen environments typical of contaminated sites, researchers can develop strategies to maintain optimal bacterial metabolism under such conditions.

Stress Response Engineering:
The selective expression of nuoK during stress conditions suggests it may be part of a critical adaptive response . Engineering strains with modified nuoK expression could potentially enhance survival and activity of bioremediation agents in challenging environmental conditions.

Biomarker Development:
The expression pattern of nuoK could potentially serve as a biomarker for monitoring the metabolic state of M. vanbaalenii during bioremediation processes. This could help assess whether bacteria at contaminated sites are maintaining optimal metabolic activity for pollutant degradation.

Co-metabolism Enhancement:
Understanding how respiratory components like nuoK support the co-metabolism of multiple substrates could lead to improved bioremediation strategies for sites contaminated with complex mixtures of pollutants.

What analytical techniques are most appropriate for monitoring nuoK expression in environmental samples?

Monitoring nuoK expression in environmental samples presents unique challenges but can provide valuable insights for bioremediation research:

Nucleic Acid-Based Methods:

• Quantitative RT-PCR with primers specific to M. vanbaalenii nuoK

• Digital droplet PCR for absolute quantification in complex environmental samples

• RNA-seq from total environmental RNA with specific mapping to M. vanbaalenii sequences

Protein-Based Methods:

• Targeted proteomics using selected reaction monitoring (SRM) or parallel reaction monitoring (PRM)

• Antibody-based detection methods specific to nuoK or its His-tagged recombinant version

• Activity-based protein profiling to detect active respiratory complexes

Environmental Transcriptomics Workflow:

• Sample collection from contaminated site

• RNA preservation and extraction using protocols optimized for environmental samples

• rRNA depletion to enrich for bacterial mRNA

• Library preparation and sequencing

• Bioinformatic analysis with specific mapping to M. vanbaalenii nuoK and related genes

• Correlation of expression data with environmental parameters and degradation rates

These techniques can provide insights into the in situ expression of nuoK during actual bioremediation processes, helping to bridge the gap between laboratory studies and field applications.

What are the key unresolved questions regarding Mycobacterium vanbaalenii nuoK function?

Despite the information available, several fundamental questions about nuoK remain unresolved:

• The precise role of nuoK in proton translocation during respiratory electron transport

• The structural basis for selective nuoK expression during oxygen limitation

• The potential for modified Complex I assemblies during stress response

• The specific contribution of nuoK to energy generation during polycyclic aromatic hydrocarbon metabolism

• The evolutionary adaptations of nuoK that might support M. vanbaalenii's unusual metabolic capabilities

What emerging technologies might advance nuoK research in the coming years?

Several emerging technologies hold promise for advancing our understanding of nuoK:

Single-Cell Technologies:
Analysis of nuoK expression at the single-cell level could reveal population heterogeneity during adaptation and stress response.

Cryogenic Electron Microscopy:
Advances in cryo-EM technology may allow determination of high-resolution structures of the complete respiratory complex containing nuoK under different physiological conditions.

Synthetic Biology Approaches:
Development of minimal respiratory complexes or hybrid complexes containing nuoK could provide insights into its essential functions.

In situ Structural Biology:
Emerging techniques for studying protein structure within intact cells could reveal the native conformation and interactions of nuoK in its cellular context.

Systems Biology Integration: Multi-omics approaches integrating transcriptomics, proteomics, metabolomics, and fluxomics data could provide a comprehensive understanding of nuoK's role in the broader metabolic network.