Recombinant Mycobacterium vanbaalenii UPF0353 protein Mvan_2751 (Mvan_2751)

What is the complete amino acid sequence of Mvan_2751?

The full amino acid sequence of Mvan_2751 consists of 335 amino acids as follows:

MTLPLLGPMSLSGFEHPWFFLFFLVVLGLVALYVIVM
GRHRRLRFANMELLESVAPKRPSRWRHLPAVLLILSL
MSFTVAMACPTHDVRIPRNRAVVMLVIDVSQSMRATD
VAPNRLVAAQEAAKQFADQLTPGINLGLIAYAGTATV
LVSPTTNREATKAAIDKLQLADRTATGEGIFTALQAV
ATVGAVIGGGDEPPPARIVLMSDGKETVPSNPDNPKG
AYTAARTAKDQGVPISTVSFGTPYGYVEINDQRQPVP
VDDEMLKKIADLSGGDAFTASSLKQLKQVFTNLQKQI
GYETIKGDASVGWLRIGSLVLALAALGALLINRRLPN

This sequence reveals a membrane-associated protein with multiple hydrophobic regions that are characteristic of transmembrane domains. The protein contains 335 amino acids with a predicted molecular weight of approximately 36 kDa.

How is Mvan_2751 classified and what is known about its functional domains?

Mvan_2751 is classified as a UPF0353 family protein found in Mycobacterium vanbaalenii strain DSM 7251/PYR-1. The "UPF" designation (Uncharacterized Protein Family) indicates that while this protein has been identified and sequenced, its precise biological function remains to be fully elucidated .

Analysis of the amino acid sequence suggests the presence of:

• N-terminal transmembrane domains (amino acids 1-60)

• A central hydrophilic region that may be involved in substrate binding

• C-terminal region with conserved motifs typical of membrane-associated proteins

The protein shares structural similarities with other mycobacterial membrane proteins that function in transport mechanisms, suggesting a potential role in membrane-associated processes, though specific biochemical activities have yet to be confirmed experimentally.

What expression systems are most effective for producing recombinant Mvan_2751?

For optimal expression of recombinant Mvan_2751, E. coli-based expression systems have demonstrated reliable results. The protein has been successfully expressed with a His-tag, facilitating purification via affinity chromatography . When designing expression constructs, researchers should consider:

• Codon optimization for the expression host (particularly important for mycobacterial proteins expressed in E. coli)

• Selection of appropriate fusion tags that don't interfere with protein folding (His-tag has been validated)

• Growth conditions optimization: lower induction temperatures (16-20°C) may improve protein folding

• Inclusion of protease inhibitors during purification to prevent degradation

For membrane-associated proteins like Mvan_2751, detergent screening (e.g., DDM, LDAO, or CHAPS) is often necessary to maintain protein stability after extraction from membranes. Expression yields of 2-5 mg/L culture have been reported using optimized protocols with IPTG induction in E. coli.

How should inter-individual variability be addressed in experimental design when studying proteins like Mvan_2751?

When designing experiments involving Mvan_2751 or similar proteins, accounting for inter-individual variability is crucial for generating reliable and reproducible results. Studies have demonstrated that ignoring such variability can obscure experimental outcomes and lead to misinterpretation of data .

Recommended approaches include:

• Characterization of baseline response patterns before proceeding with protein-specific experiments

• Multivariate clustering of response types to identify distinct phenotypic patterns

• Systematic incorporation of individual response types into experimental design

• Use of appropriate statistical methods that account for this variability

Research has empirically confirmed that systematic incorporation of individual response types produces significantly different results compared to experimental pools where this variation is not accounted for . For Mvan_2751 studies, this might involve characterizing baseline cellular responses to the protein across multiple cell lines or model organisms before proceeding with functional assays.

What methodologies are most effective for studying Mvan_2751 membrane integration and topology?

As Mvan_2751 possesses transmembrane domains, determining its precise membrane topology is essential for understanding its function. Several complementary approaches are recommended:

• Protease accessibility assays: Using proteases like trypsin or proteinase K to digest exposed regions while membrane-embedded segments remain protected. Subsequent analysis by mass spectrometry can map the protected regions.

• Cysteine scanning mutagenesis: Introducing cysteine residues at various positions and assessing their accessibility to membrane-impermeable sulfhydryl reagents.

• Fluorescence resonance energy transfer (FRET): Tagging different domains with fluorescent markers to determine their relative positions.

• Cryo-electron microscopy: For high-resolution structural analysis of the protein within a membrane environment.

For Mvan_2751 specifically, combining these approaches with computational prediction tools like TMHMM or Phobius can generate a comprehensive model of membrane integration. Researchers should be aware that detergent solubilization may alter native conformation, necessitating validation in lipid bilayer systems.

How can conflicting results in Mvan_2751 ubiquitination studies be reconciled?

When investigating ubiquitination patterns of Mvan_2751, researchers may encounter seemingly contradictory results. Studies on related UPF proteins have shown that while deletion of Upf1 increases the amount of ubiquitinated protein detected, the efficiency of ubiquitination remains similar between wild-type and deletion strains . This apparent contradiction can be reconciled by considering:

• The increased detection of ubiquitinated proteins in deletion strains likely reflects accumulation due to impaired degradation rather than enhanced ubiquitination

• The ratio between ubiquitinated and non-ubiquitinated forms provides a more accurate measure of ubiquitination efficiency than absolute amounts

For experimental validation, researchers should:

• Conduct time-course experiments to distinguish between effects on ubiquitination rate versus degradation rate

• Use proteasome inhibitors to differentiate between these processes

• Quantify the ratio of ubiquitinated to total protein rather than absolute amounts

• Compare multiple ubiquitination sites using mass spectrometry to identify site-specific effects

This approach allows for more accurate interpretation of ubiquitination data and avoids misattributing degradation defects to ubiquitination changes .

What controls are essential when evaluating Mvan_2751 interactions with heat shock proteins?

When investigating interactions between Mvan_2751 and heat shock proteins such as Hsp70, which have been implicated in the degradation of misfolded proteins, several critical controls must be implemented:

• Specificity controls:

  • Compare binding to related proteins from the same family

  • Include structurally similar but functionally distinct proteins as negative controls

  • Use mutant variants with altered folding properties to distinguish specific from non-specific interactions

• Condition-dependent interactions:

  • Assess interactions under normal and stress conditions (heat shock, oxidative stress)

  • Test binding in the presence of ATP versus ADP to evaluate chaperone cycle dependency

  • Examine interactions at different stages of protein expression and maturation

• Technical validation:

  • Confirm interactions using multiple methods (co-IP, FRET, proximity ligation)

  • Conduct reverse immunoprecipitation experiments

  • Include appropriate isotope-labeled controls for mass spectrometry

Failure to implement these controls may lead to misinterpretation of chaperone interactions as functionally significant when they may represent normal quality control processes for newly synthesized proteins .

How can Mvan_2751 be utilized in studying protein quality control pathways across species?

Mvan_2751 represents a valuable model for comparative studies of protein quality control mechanisms across bacterial species. To effectively utilize this protein:

• Cross-species experimental design:

  • Express Mvan_2751 in heterologous systems (E. coli, yeast, mammalian cells)

  • Compare degradation kinetics and quality control recruitment across systems

  • Identify conserved versus species-specific recognition elements

• Chimeric protein approach:

  • Create fusion proteins combining domains from Mvan_2751 with domains from quality control substrates in other species

  • Determine which regions confer recognition by quality control machinery

  • Assess whether the faux 3′-UTR-dependent degradation mechanism applies across species

• Quantitative comparative analysis:

  • Use SILAC or TMT labeling with mass spectrometry to compare interactomes across species

  • Develop kinetic models of degradation pathways

  • Identify rate-limiting steps in different organisms

This approach has been successful with other proteins like the human von Hippel-Lindau (VHL) protein, which showed different degradation patterns depending on whether it was expressed alone or with its chaperone human elongin BC in yeast .

What are the most promising approaches for determining the physiological role of Mvan_2751 in Mycobacterium vanbaalenii?

Despite structural characterization, the physiological function of Mvan_2751 remains largely unknown. To elucidate its role:

• Genetic approaches:

  • Generate knockout and conditional mutants using CRISPR-Cas9 or homologous recombination

  • Perform complementation studies with wild-type and mutant variants

  • Conduct phenotypic profiling under various growth conditions

• Transcriptomic and proteomic profiling:

  • Compare expression patterns in wild-type and mutant strains

  • Identify co-regulated genes to establish functional networks

  • Perform ribosome profiling to assess translational impacts

• Substrate identification:

  • Conduct affinity purification coupled with mass spectrometry to identify binding partners

  • Perform metabolomic analysis to identify changes in metabolite profiles

  • Use crosslinking approaches to capture transient interactions

• Evolutionary analysis:

  • Compare conservation patterns across mycobacterial species

  • Identify co-evolving gene clusters

  • Examine horizontal gene transfer patterns

Combining these approaches can provide complementary lines of evidence to establish the physiological role of Mvan_2751 in processes such as membrane transport, stress response, or environmental adaptation.