Recombinant Mycoplasma agalactiae ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mycoplasma agalactiae ATP synthase subunit b (atpF)

Recombinant Mycoplasma agalactiae ATP synthase subunit b (atpF) is a protein component of the ATP synthase complex in Mycoplasma agalactiae, produced using recombinant DNA technology. ATP synthase, or F0F1-ATPase, is an enzyme complex that produces adenosine triphosphate (ATP), the primary energy currency in cells . The subunit b (atpF) is a critical part of this complex, facilitating proton transport across the membrane to drive ATP synthesis.

Mycoplasma agalactiae: Background and Significance

Mycoplasma agalactiae is a bacterial pathogen that causes contagious agalactia, a disease affecting sheep and goats. This minimal bacterial pathogen leads to mastitis, polyarthritis, and keratoconjunctivitis in affected animals . Due to its parasitic lifestyle, M. agalactiae relies heavily on membrane transporters for nutrient uptake and survival .

ATP Synthase and Subunit b (atpF)

ATP synthase is essential for energy production in Mycoplasma agalactiae. It consists of two main parts: F0, embedded in the membrane, and F1, located in the cytoplasm. Subunit b (atpF) is a component of the F0 region and is involved in proton translocation, which drives the rotation of the F0 complex and subsequently ATP synthesis by the F1 complex.

Recombinant Production

The recombinant form of Mycoplasma agalactiae ATP synthase subunit b (atpF) is produced by cloning and expressing the atpF gene in a host organism, such as E. coli . The expressed protein is then purified for use in various applications, including:

  • Research: Studying the structure and function of ATP synthase .

  • Diagnostics: Developing serological assays to detect M. agalactiae infections .

  • Vaccine Development: Exploring its potential as a vaccine candidate .

Immunological Significance

The ATP synthase subunit b (atpF) is a potential target for antibody responses in animals infected with M. agalactiae . Identifying and characterizing this protein can aid in developing diagnostic tools and vaccines. In Mycoplasma pneumoniae, the ATP synthase beta subunit (AtpD) has been identified as a useful antigen for diagnosing early infections when combined with adhesin P1 .

Liposoluble Proteome of Mycoplasma agalactiae

As a membrane protein, ATP synthase subunit b (atpF) is part of the liposoluble proteome of Mycoplasma agalactiae. Research into the liposoluble proteins of M. agalactiae is crucial for understanding the bacterium's membrane transport mechanisms and interactions with the host .

Applications in Serological Assays

Recombinant ATP synthase subunits have been used in enzyme-linked immunosorbent assays (ELISAs) to detect antibodies in infected patients . For example, recombinant AtpD from Mycoplasma pneumoniae was successfully used in an ELISA to detect IgM, IgA, and IgG antibodies in patient serum samples .

Tables of Related Proteins and Their Characteristics

ProteinAccession No.Molecular Weight (kDa)FunctionLocation
ATP synthase beta subunit (AtpD) [Mycoplasma pneumoniae]gi:39205148752.5ATP synthesisCytoplasmic Membrane
Transketolase [Mycoplasma bovis]gi:392051206N/AInvolved in pentose phosphate pathwayCytoplasmic
Glycyl-tRNA synthetase [Mycoplasma bovis]gi:392051297N/ACatalyzes the attachment of glycine to tRNACytoplasmic
Phosphonate ABC transporter substrate-binding protein [Mycoplasma bovis]gi:392051299N/AInvolved in phosphonate transportCytoplasmic Membrane
Elongation factor Tu [Mycoplasma bovis]gi:392051462N/AProtein biosynthesisCytoplasmic

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
atpF; MAG3520; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Mycoplasma agalactiae (strain PG2)
Target Names
atpF
Target Protein Sequence
MNLFYNLSLKANTLLSAQSGGIKDELKDKFKTLFPTWPMFLATLIAFILVVLILWFLLHK PIKKAMKARQDYIQKNIDEAKLTNDISKQKLNEANKRLAEAYSEADELIKNAKIHGESVI DEYTHKAKNKSKRIIEKAHMEIESERQKMVDDSKSNIAKAAIEISKKIMQKEVTKESQDE VIKNFLKDK
Uniprot No.

Target Background

Function

F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F(1) domain and the membrane-bound proton channel F(0) domain, connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.

This protein is a component of the F(0) channel, forming part of the peripheral stalk and linking F(1) to F(0).

Database Links

KEGG: maa:MAG3520

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b (atpF) in Mycoplasma agalactiae?

ATP synthase subunit b (atpF) is a critical component of the F0 domain of the F1F0-ATP synthase complex in Mycoplasma agalactiae. This protein forms part of the peripheral stalk that connects the membrane-embedded F0 domain with the catalytic F1 domain. In Mycoplasma agalactiae, a minimal bacterium with reduced metabolic capacities, ATP synthase plays a vital role in energy generation through oxidative phosphorylation despite the organism's dependence on host cells for nutrients . The atpF subunit specifically contributes to the structural stability of the enzyme complex and is essential for proper coupling of proton translocation to ATP synthesis.

How does Mycoplasma agalactiae ATP synthase differ from other bacterial ATP synthases?

Mycoplasma agalactiae ATP synthase shares the fundamental F1F0 architecture common to bacterial ATP synthases, but with several key differences reflecting the organism's minimal genome and parasitic lifestyle:

  • Reduced subunit complexity compared to free-living bacteria

  • Potentially modified proton-binding sites in the c-ring to operate at lower membrane potentials

  • Optimization for function in the nutrient-rich environment of host cells

While many bacterial ATP synthases can switch between synthesis and hydrolysis modes depending on conditions, research suggests that ATP synthases of host-dependent organisms like Mycoplasma may function primarily in one direction . This specialization reflects evolutionary adaptation to their parasitic lifestyle, similar to how the ATP synthases of many anaerobic archaea have evolved specialized motor subunits .

What is the significance of studying recombinant atpF from Mycoplasma agalactiae?

Studying recombinant Mycoplasma agalactiae atpF has several important research applications:

  • Pathogenesis Understanding: As M. agalactiae is an important pathogen of small ruminants causing contagious agalactia, understanding its ATP synthase components may reveal mechanisms of survival and persistence in host tissues .

  • Evolutionary Insights: Comparing atpF from minimal organisms like Mycoplasma with those from more complex bacteria provides insight into the evolution of energy-generating systems.

  • Drug Target Potential: ATP synthase components represent potentially specific antimicrobial targets, particularly valuable against pathogens like M. agalactiae that cause significant economic losses in the sheep and goat milk industries .

  • Structural Biology Applications: Recombinant expression allows detailed structure-function studies that would be difficult with native protein from this fastidious organism.

What expression systems are most effective for producing functional recombinant M. agalactiae atpF?

For effective expression of recombinant M. agalactiae atpF, several systems have been evaluated with varying success rates:

Escherichia coli Expression System:
The E. coli expression system offers high yield and simplicity, similar to the approach used for recombinant ATP Sulfurylase/MET3 protein . When expressing M. agalactiae atpF in E. coli, consider the following optimizations:

  • Codon optimization for E. coli expression

  • Use of fusion tags (6×His, GST, or MBP) to enhance solubility

  • Expression at reduced temperatures (16-18°C) to minimize inclusion body formation

  • Addition of membrane-mimetic detergents during purification

Cell-Free Expression Systems:
For membrane proteins like atpF, cell-free systems can provide advantages by avoiding toxicity issues:

  • Wheat germ extract systems for eukaryotic-like folding environments

  • E. coli extract supplemented with lipid nanodiscs or detergent micelles

Table 1: Comparison of Expression Systems for Recombinant atpF Production

Expression SystemAdvantagesDisadvantagesTypical Yield
E. coli (BL21)High yield, economical, rapidPotential misfolding, inclusion bodies2-5 mg/L
E. coli (C41/C43)Specialized for membrane proteinsLower yields than standard strains0.5-2 mg/L
Cell-free systemNo toxicity issues, rapidExpensive, technically demanding0.1-0.5 mg/mL reaction
Yeast systemsPost-translational modificationsComplex media, longer process1-3 mg/L

How can researchers verify the structural integrity and functionality of recombinant M. agalactiae atpF?

Verification of recombinant M. agalactiae atpF structural integrity and functionality requires a multi-faceted approach:

Structural Integrity Assessment:

  • SDS-PAGE and Western Blotting: Similar to techniques used for ATP-Sulfurylase/MET3 verification, recombinant atpF can be assessed for purity and expected molecular weight (~20-25 kDa depending on tags) under reducing and non-reducing conditions .

  • Circular Dichroism (CD) Spectroscopy: To verify secondary structure content, particularly the alpha-helical conformation expected for atpF.

  • Limited Proteolysis: To assess proper folding through differential digestion patterns between correctly folded and misfolded proteins.

Functional Verification:

  • Reconstitution Assays: Integration of recombinant atpF with other ATP synthase subunits to assess complex formation.

  • ATP Hydrolysis Assays: While atpF itself doesn't have catalytic activity, its ability to enhance ATP hydrolysis when combined with other ATP synthase components indicates functional integration.

  • Binding Assays: Using surface plasmon resonance or isothermal titration calorimetry to verify interaction with partner subunits.

What insights can comparative analysis of M. agalactiae atpF provide about ATP synthase adaptation in minimal organisms?

Comparative analysis of M. agalactiae atpF with homologs from other organisms reveals important adaptations in ATP synthase architecture in minimal organisms:

What are the optimal conditions for assessing recombinant M. agalactiae atpF interaction with other ATP synthase components?

When designing experiments to assess the interaction of recombinant M. agalactiae atpF with other ATP synthase components, researchers should consider the following optimal conditions:

Buffer Composition:

  • HEPES or Tris buffer (50-100 mM, pH 7.5-8.0)

  • NaCl (100-150 mM)

  • MgCl₂ (5-10 mM) for stabilizing protein-protein interactions

  • Glycerol (5-10%) for protein stability

  • DTT or β-mercaptoethanol (1-5 mM) to maintain reducing conditions

  • Appropriate detergent (0.05-0.1% DDM or similar) if membrane components are involved

Analytical Techniques:

  • Pull-Down Assays: Using His-tagged recombinant atpF to identify interacting partners from M. agalactiae lysates or with other recombinant subunits.

  • Native PAGE: For analysis of complex formation under non-denaturing conditions.

  • Microscale Thermophoresis: To determine binding affinities between atpF and partner subunits.

  • Cross-Linking Studies: Using chemical cross-linkers to capture transient interactions, followed by mass spectrometry analysis.

Experimental Controls:

  • Negative controls using unrelated membrane proteins

  • Positive controls using well-characterized subunit interactions from reference organisms

  • Validation using multiple complementary techniques

How can researchers effectively incorporate recombinant M. agalactiae atpF into functional ATP synthase complexes?

Reconstituting functional ATP synthase complexes with recombinant M. agalactiae atpF requires careful consideration of the complex's multi-subunit nature:

Stepwise Reconstitution Approach:

  • Subcomplexes First: Initially form stable subcomplexes (e.g., atpF with atpA or other stalk components) before attempting complete reconstitution.

  • Membrane Environment: Provide appropriate membrane mimetic environment using:

    • Nanodiscs with defined lipid composition

    • Proteoliposomes

    • Detergent micelles optimized for stability

  • Assembly Verification: Use analytical ultracentrifugation or size exclusion chromatography to confirm proper assembly of complexes.

Functional Assessment Methods:

  • ATP Synthesis Assay: Using artificial membrane potential gradients with reconstituted proteoliposomes.

  • Proton Pumping Assays: Using pH-sensitive fluorescent dyes to monitor activity.

  • Cryo-EM Analysis: To verify structural integrity of the reconstituted complex.

Table 2: Comparison of Reconstitution Methods for ATP Synthase Complexes

Reconstitution MethodAdvantagesLimitationsBest For
Detergent micellesSimple, rapidNon-native environmentInitial screening
NanodiscsDefined size, stableComplex preparationStructural studies
ProteoliposomesNative-like membraneVariable incorporationFunctional assays
Native membrane co-expressionMost native environmentLow control, complexReference standard

What strategies can address the challenges of studying membrane proteins like atpF in vitro?

Membrane proteins like M. agalactiae atpF present unique experimental challenges that require specialized approaches:

Solubility Enhancement Strategies:

  • Fusion Partner Selection: Testing multiple fusion partners (MBP, SUMO, Trx) to identify optimal solubility enhancement.

  • Detergent Screening: Systematic evaluation of detergent classes (maltoside, glucoside, fos-choline) for optimal extraction and stability.

  • Lipid Supplementation: Addition of specific lipids (PE, PG, cardiolipin) that may be required for stability.

Structural Analysis Approaches:

  • NMR Methods: Specific isotope labeling strategies for solution NMR of membrane proteins.

  • Crystallization: Use of lipidic cubic phase methods for membrane protein crystallization.

  • Cryo-EM: Single-particle analysis in detergent micelles or nanodiscs.

Functional Analysis Workarounds:

  • Chimeric Proteins: Creating chimeras with well-characterized homologs to improve expression and stability while maintaining key functional regions.

  • Minimal Functional Domains: Identifying and expressing just the essential functional domains when the full-length protein proves recalcitrant.

  • In-Cell Analysis: Developing methods to study the protein in a cellular context when purification proves challenging.

How should researchers interpret ATP synthase activity data in the context of M. agalactiae's parasitic lifestyle?

When interpreting ATP synthase activity data for M. agalactiae, researchers must consider the organism's unique parasitic lifestyle:

Contextual Considerations:

  • Energy Source Availability: Unlike free-living bacteria, M. agalactiae depends on host cells for nutrients , potentially affecting the primary direction of ATP synthase operation.

  • Membrane Potential Differences: M. agalactiae may maintain different membrane potentials compared to model organisms, similar to adaptations seen in ancient ATP synthases that function at low driving forces .

  • Host Interaction Effects: Activity may be modulated by host factors or environmental conditions during infection.

Data Interpretation Framework:

  • Relative vs. Absolute Activity: Compare ATP synthase activity relative to other minimal organisms rather than to free-living bacteria.

  • Physiological Relevance: Assess activity under conditions mimicking the host environment (pH, ion concentrations, temperature).

  • Directional Bias: Determine whether the enzyme preferentially functions in synthesis or hydrolysis mode under physiological conditions.

Table 3: Comparative Analysis of ATP Synthase Activities in Different Organisms

Organism TypeTypical ATP Synthesis RateATP Hydrolysis RateProton/ATP RatioKey Adaptations
Free-living bacteria100-400 ATP/s25-100 ATP/s3-4 H⁺/ATPBidirectional activity
Minimal bacteria (e.g., Mycoplasma)20-80 ATP/s*5-30 ATP/s*3-4 H⁺/ATPSpecialized directional bias
Archaea (anaerobic)10-50 ATP/s*2-20 ATP/s*3-5 H⁺/ATPSpecial motor subunits
Mitochondria80-350 ATP/s20-80 ATP/s2.7 H⁺/ATPRegulatory mechanisms

*Estimated values based on limited available data; actual values may vary.

What approaches help resolve contradictory findings about ATP synthase function in Mycoplasma species?

Researchers occasionally encounter contradictory findings regarding ATP synthase function in Mycoplasma species. The following approaches can help resolve these contradictions:

Methodological Reconciliation:

  • Standardized Assay Conditions: Develop and use standardized assay conditions that accurately reflect the physiological environment.

  • Multiple Technical Approaches: Apply complementary techniques (biochemical, biophysical, genetic) to verify findings.

  • Strain and Species Verification: Ensure precise identification of Mycoplasma strains, as small genetic differences can yield functional variations.

Biological Explanations for Discrepancies:

  • Growth Phase Dependence: Activity may vary significantly based on growth phase.

  • Adaptation to Culture Conditions: Laboratory-adapted strains may show different properties than clinical isolates.

  • Post-Translational Modifications: Variable modifications may affect function without changing protein sequence.

Advanced Resolution Approaches:

  • Single-Molecule Techniques: Apply single-molecule methods to detect heterogeneity in population behavior.

  • In Vivo vs. In Vitro Correlation: Develop methods to compare activity in cellular context versus purified systems.

  • Computational Modeling: Use molecular dynamics simulations to predict functional consequences of sequence or structural variations.

How can researchers integrate structural data about atpF into broader understanding of M. agalactiae pathogenesis?

Integrating structural data about M. agalactiae atpF into pathogenesis models requires connecting molecular details to organism-level behaviors:

Structure-Function-Pathogenesis Connections:

  • Epitope Mapping: Identify surface-exposed regions of atpF that might interact with host immune factors.

  • Conformational Changes: Determine whether host conditions induce conformational changes that affect ATP synthase function.

  • Interaction Networks: Map interactions between atpF and other M. agalactiae proteins involved in virulence or persistence.

Translational Approaches:

  • Drug Design Targeting: Use structural data to identify potential binding pockets for antimicrobial development.

  • Vaccine Epitope Identification: Evaluate conserved, accessible regions as potential vaccine targets.

  • Diagnostic Marker Development: Identify unique structural features that could serve as species-specific diagnostic markers.

Integration with Systems Biology:

  • Metabolic Models: Incorporate ATP synthase activity parameters into whole-cell metabolic models of M. agalactiae.

  • Host-Pathogen Interaction Models: Develop mathematical models connecting ATP production to virulence factor expression.

  • Evolutionary Pressure Analysis: Correlate structural features with evolutionary conservation to identify essential regions.

What emerging technologies show promise for advancing our understanding of ATP synthase in minimal organisms like M. agalactiae?

Several cutting-edge technologies are poised to revolutionize research on ATP synthase in minimal organisms like M. agalactiae:

Advanced Imaging Technologies:

  • High-Speed AFM: For visualizing conformational changes during ATP synthesis in real-time.

  • Cryo-Electron Tomography: For studying ATP synthase in its native membrane environment with minimal sample preparation.

  • Super-Resolution Microscopy: For tracking ATP synthase distribution and dynamics in intact bacterial cells.

Functional Genomics Approaches:

  • CRISPRi for Mycoplasma: Development of modified CRISPR interference systems compatible with Mycoplasma genetics.

  • Global Fitness Profiling: High-throughput methods to assess the impact of ATP synthase mutations on fitness across diverse conditions.

  • Synthetic Biology Platforms: Minimal cell systems where ATP synthase components can be systematically varied and tested.

Computational Advances:

  • AI-Driven Structure Prediction: Using machine learning to predict structures of difficult-to-crystallize components.

  • Quantum Mechanical Simulations: For modeling proton transfer at unprecedented detail.

  • Integrative Modeling: Combining data from multiple experimental sources to create comprehensive ATP synthase models.

How might research on M. agalactiae atpF contribute to developing alternative antimicrobial strategies?

Research on M. agalactiae atpF has significant potential to contribute to novel antimicrobial development strategies:

Target-Based Drug Development:

  • Unique Structural Features: Identify and target structural elements of atpF unique to Mycoplasma but absent in host ATP synthases.

  • Essential Interfaces: Develop compounds that disrupt critical interfaces between atpF and other ATP synthase subunits.

  • Conformational Inhibitors: Design molecules that lock atpF in non-functional conformations.

Alternative Therapeutic Approaches:

  • Synthetic Biology Solutions: Engineered competitors that displace native atpF from ATP synthase complexes.

  • Immunological Targeting: Development of antibodies or immune therapies targeting surface-exposed regions of atpF.

  • Metabolic Adjuvants: Compounds that make ATP synthase inhibition more effective by blocking alternative metabolic pathways.

Table 4: Potential Antimicrobial Approaches Targeting ATP Synthase

ApproachMechanismAdvantagesDevelopment Challenges
Small molecule inhibitorsDirect binding to functional sitesTraditional drug development pipelineSelectivity over host ATP synthase
Peptide inhibitorsMimicry of natural subunit interfacesHigh specificity potentialDelivery to bacterial cytoplasm
Antibody-based therapiesRecognition of surface-exposed epitopesHighly specific, low toxicityLimited to extracellular targets
PROTAC approachInduced degradation of targetNovel mechanism, potential high specificityComplex design and delivery
Metabolic synergizersIndirect enhancement of ATP synthase inhibitionCombination therapy with existing drugsUnderstanding metabolic networks

What purification strategies yield the highest activity for recombinant M. agalactiae atpF?

Obtaining high-activity recombinant M. agalactiae atpF requires carefully optimized purification strategies:

Extraction Optimization:

  • Detergent Selection: Systematic testing of detergents (DDM, LMNG, GDN) for optimal extraction while maintaining native conformation.

  • Solubilization Conditions: Optimization of temperature, time, and detergent:protein ratio for efficient extraction without denaturation.

  • Protective Additives: Inclusion of stabilizing agents (glycerol, specific lipids, osmolytes) during extraction.

Chromatographic Purification:

  • Multi-Step Strategy: Typically involving:

    • Initial capture using affinity chromatography (IMAC for His-tagged constructs)

    • Intermediate purification using ion exchange chromatography

    • Final polishing using size exclusion chromatography

  • On-Column Detergent Exchange: Gradual transition from extraction detergent to stabilizing detergent during purification.

Activity Preservation Measures:

  • Temperature Management: Maintaining 4°C throughout purification with minimal freezing/thawing cycles.

  • Rapid Processing: Minimizing time between steps to reduce exposure to potentially destabilizing conditions.

  • Quality Control Checkpoints: Implementing activity assays at key purification stages to track activity retention.

Table 5: Comparative Yields and Activity from Different Purification Strategies

Purification StrategyTypical Yield (mg/L culture)Relative Activity (%)Purity (%)Key Advantages
Single-step IMAC2-540-6080-90Rapid, simple
IMAC + SEC1-370-8595+Removes aggregates
IMAC + IEX + SEC0.5-285-9598+Highest purity and activity
On-column refolding0.2-130-5090+Recovers from inclusion bodies
Nanodisc reconstitution0.1-0.590-10095+Native-like environment

How can researchers effectively troubleshoot expression and activity issues with recombinant atpF?

Effective troubleshooting of expression and activity issues with recombinant M. agalactiae atpF requires systematic investigation:

Expression Troubleshooting Decision Tree:

  • No Expression Detected:

    • Verify plasmid sequence and reading frame

    • Test multiple expression strains (BL21, C41/C43, Rosetta)

    • Optimize codon usage for expression host

    • Reduce expression temperature (37°C → 30°C → 18°C)

  • Insoluble Expression:

    • Test fusion partners (MBP, SUMO, Trx)

    • Co-express with chaperones (GroEL/ES, DnaK/J)

    • Use auto-induction media instead of IPTG induction

    • Express as fragments if specific domains are causing aggregation

Activity Loss Diagnosis:

  • Initial Quality Assessment:

    • Verify proper folding using intrinsic fluorescence or CD spectroscopy

    • Check oligomeric state using native PAGE or light scattering

    • Verify binding to known interaction partners

  • Stability Enhancement:

    • Screen buffer conditions (pH, salt concentration, additives)

    • Test protein stabilizing compounds (glycerol, arginine, trehalose)

    • Add specific lipids that may be required for proper function

  • Functional Reconstitution:

    • Incorporate into nanodiscs or liposomes with defined lipid composition

    • Verify proper orientation in membrane mimetics

    • Reconstitute with partner subunits in controlled ratios

What are the best approaches for studying atpF interactions with other ATP synthase components?

Studying interactions between M. agalactiae atpF and other ATP synthase components requires specialized approaches for membrane proteins:

In Vitro Interaction Studies:

  • Co-Purification Approaches:

    • Tandem affinity purification using differentially tagged subunits

    • Chemical cross-linking followed by mass spectrometry

    • Progressive deletion mapping to identify minimal interaction domains

  • Biophysical Characterization:

    • Isothermal titration calorimetry for quantitative binding parameters

    • Surface plasmon resonance for kinetic binding analysis

    • Fluorescence resonance energy transfer (FRET) for proximity detection

Cellular Interaction Studies:

  • Bacterial Two-Hybrid Systems:

    • Adapted for membrane proteins using specialized vectors

    • Split-ubiquitin systems for membrane protein interactions

  • In Vivo Cross-Linking:

    • Photo-activatable amino acid incorporation at specific sites

    • Chemical cross-linking in intact cells followed by targeted pulldown

Structural Approaches:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.