Recombinant Mycoplasma arthritidis ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize development accordingly.
Synonyms
atpF; MARTH_orf043; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Mycoplasma arthritidis (strain 158L3-1)
Target Names
atpF
Target Protein Sequence
MNFNINQSSISDAITKTFGNLTINWPFFVFSFLTLILVVTIVTLLVYKPLKKMLKNRQNF IQNNIDESIKAKEAALKVQEEIDEKIIESSKHANQIIEQAKLERERIINNGIEVSNKKAE IIIEQANILVTKSQAEFENKQRKIIVENAVEIAKKIIGREIRDKDNLKMIEEMLES
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembraneous) and the F(0) membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis within the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structure and function of ATP synthase in Mycoplasma species?

ATP synthase (F₁F₀ ATPase) in Mycoplasma species plays a critical role in energy metabolism despite their reduced genomes. The typical F₁F₀ ATPase (Type 1) consists of a membrane-embedded F₀ sector forming a proton channel and a catalytic F₁ sector that synthesizes or hydrolyzes ATP. This enzyme complex is responsible for ATP synthesis through oxidative phosphorylation or, when operating in reverse, can hydrolyze ATP to generate a proton gradient.

These F₁-like ATPases in mycoplasmas contain four proteins with predicted structures similar to the α, β, γ, and ε subunits of typical F₁ ATPases, but their membrane components differ significantly from the conventional F₀ sector .

How does the atpF gene differ functionally from other ATP synthase components?

The ATP synthase subunit b (atpF) serves as a critical component of the peripheral stalk in the F₀ sector, connecting the membrane-embedded portions to the catalytic F₁ sector. Unlike the α and β subunits that possess catalytic activity, the b subunit plays primarily a structural role, maintaining the integrity of the ATP synthase complex and enabling proper energy coupling.

In typical bacterial F₁F₀ ATPases, the b subunit features:

  • An N-terminal membrane-anchoring domain

  • A central dimerization region forming coiled-coil structures

  • A C-terminal domain interacting with the F₁ sector

This architecture creates a rigid stator that prevents rotation of parts of the F₁ sector during catalysis, allowing the enzyme to function properly. While the catalytic F₁ components (α, β) are more conserved evolutionarily, the membrane components including the b subunit show greater variation across species, reflecting adaptation to different membrane environments .

What phylogenetic patterns exist among ATP synthase genes in Mycoplasma species?

Phylogenomic studies have revealed fascinating evolutionary patterns in mycoplasma ATP synthase genes. Three distinct types of ATP synthase gene clusters have been identified in Mycoplasma species:

TypeGene OrganizationDistributionEvolutionary Features
Type 1Typical 8-gene F₁F₀ ATPase operonMost mycoplasmasSimilar to other bacteria
Type 27-gene F₁-like ATPase clusterHominis groupRapid sequence evolution
Type 37-gene F₁-like ATPase clusterMultiple groupsEvidence of horizontal gene transfer

Both Type 2 and Type 3 clusters appear to have originated from the Hominis group of mycoplasmas, with Type 3 clusters showing evidence of spreading to other phylogenetic groups through horizontal gene transfer between mycoplasmas sharing the same host .

This evolutionary scenario demonstrates that despite their genome reduction tendency, mycoplasmas have evolved and exchanged specific F₁-like ATPases with no known equivalents in other bacteria .

What are the optimal methods for cloning and expressing recombinant M. arthritidis atpF?

Based on successful approaches with other mycoplasma ATP synthase components, the following methodological framework is recommended for cloning and expressing M. arthritidis atpF:

Cloning Strategy:

  • Design primers based on the published M. arthritidis genome sequence, incorporating appropriate restriction sites or recombination sequences

  • Amplify the atpF gene using high-fidelity PCR from genomic DNA

  • Clone into an expression vector (pDEST17 has proven successful for M. pneumoniae AtpD)

  • Verify the construct by sequencing to confirm correct sequence and reading frame

Expression System Selection:
The E. coli BL21(DE3) strain has been successfully used for expressing mycoplasma ATP synthase components and represents the primary recommended system . Expression conditions should be optimized by testing:

  • IPTG concentration (typically 0.5-1 mM)

  • Induction temperature (often 25-30°C for better solubility)

  • Induction duration (4-16 hours)

  • Addition of solubility enhancers if inclusion body formation occurs

For membrane proteins like atpF with hydrophobic domains, consider using specialized E. coli strains designed for membrane protein expression or cell-free expression systems if conventional approaches yield poor results.

What purification challenges are specific to recombinant atpF and how can they be overcome?

Purification of recombinant atpF presents several challenges due to its membrane-associated nature and structural properties. A multi-step purification strategy similar to that used for M. pneumoniae AtpD can be effective :

Challenges and Solutions:

  • Membrane Protein Solubility

    • Solution: Include appropriate detergents (DDM, LDAO) during cell lysis and purification

    • Alternative: Express truncated versions excluding the transmembrane domain if only studying specific interactions

  • Protein Aggregation

    • Solution: Optimize buffer conditions (pH 7.5-8.0, 150-300 mM NaCl)

    • Add stabilizing agents like glycerol (10-15%) and reducing agents (1-5 mM DTT)

  • Purification Protocol:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) using His-tag

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography to remove aggregates

  • Verification:

    • SDS-PAGE and western blot analysis using anti-His antibodies or specific antibodies if available

    • Mass spectrometry to confirm protein identity

In published work with M. pneumoniae AtpD, researchers achieved 100% purity as estimated by densitometry, with the protein showing the expected molecular mass (~40-50 kDa) .

How can researchers verify structural integrity and functionality of purified recombinant atpF?

Verification of recombinant atpF structural integrity involves complementary analytical techniques addressing different aspects of protein structure and function:

Structural Analysis:

  • SDS-PAGE and Western Blotting: Confirms correct molecular weight and immunoreactivity. For M. pneumoniae ATP synthase components, pooled patient sera recognized the recombinant proteins but healthy donor sera did not, confirming antigenicity .

  • Circular Dichroism (CD) Spectroscopy: Evaluates secondary structure content, particularly important for confirming proper folding of the coiled-coil regions typical in atpF.

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Determines oligomeric state, as bacterial b subunits typically form dimers.

Functional Verification:

  • Binding Assays: Assess interaction with other ATP synthase components using pull-down assays or surface plasmon resonance.

  • ATP Hydrolysis Complementation: Test whether addition of purified atpF to partially assembled ATP synthase complexes restores or enhances activity.

  • Reconstitution Experiments: Combine with other ATP synthase components to form functional complexes, then measure ATP synthesis/hydrolysis activity.

Researchers working with M. mycoides F₁-like ATPases demonstrated through proteomic analyses that all seven proteins from the Type 3 cluster were produced during growth, suggesting they form a functional complex .

How can recombinant atpF be used in developing serological diagnostics for M. arthritidis infections?

ATP synthase components have demonstrated value as serological markers for mycoplasma infections. M. pneumoniae ATP synthase beta subunit (AtpD) shows significant potential in immunodiagnostics, suggesting a similar approach could be developed for M. arthritidis atpF .

Development Methodology:

  • Establish ELISA assays using purified recombinant atpF as the capture antigen

  • Optimize assay conditions including coating concentration, blocking agents, and incubation times

  • Determine separate cut-off values for IgM, IgA, and IgG antibody detection using ROC analysis

  • Validate with serum panels from confirmed M. arthritidis infections and appropriate controls

Performance Metrics from M. pneumoniae AtpD Studies:

Antibody ClassPatient GroupSensitivitySpecificityAUC Score
IgMChildren70%97%0.930
IgAChildren56%97%0.842
IgGChildren78%97%0.943
IgMAdults67%97%0.891
IgAAdults65%97%0.877
IgGAdults61%97%0.877

Notably, combining atpF with other M. arthritidis antigens might improve diagnostic performance, similar to how combining AtpD and P1 adhesin enhanced M. pneumoniae diagnostics, particularly for IgM detection in acute infections .

What methods are effective for studying atpF interactions with other ATP synthase components?

Understanding atpF interactions with other ATP synthase components requires multiple complementary approaches:

In Vitro Interaction Studies:

  • Co-immunoprecipitation (Co-IP): Using antibodies against tagged atpF to pull down interacting partners

  • Surface Plasmon Resonance (SPR): Quantifying binding kinetics and affinity constants between atpF and other ATP synthase components

  • Isothermal Titration Calorimetry (ITC): Determining thermodynamic parameters of interactions

  • Cross-linking coupled with Mass Spectrometry: Identifying interaction interfaces at the amino acid level

Structural Approaches:

  • Cryo-electron Microscopy: Visualizing the entire ATP synthase complex with atpF in its native context

  • X-ray Crystallography: Determining high-resolution structures of atpF alone or in complex with interacting partners

  • Nuclear Magnetic Resonance (NMR): Analyzing dynamic interactions for soluble domains

In Vivo Studies:

  • Bacterial Two-Hybrid Systems: Screening for interaction partners

  • Fluorescence Resonance Energy Transfer (FRET): Visualizing protein interactions in living cells

  • Split-GFP Complementation: Confirming specific interactions in the cellular environment

These approaches can reveal how atpF contributes to the structure and function of the complete ATP synthase complex, particularly important given the unique F₁-like ATPases found in mycoplasmas with novel membrane components replacing the typical F₀ sector .

How does atpF gene variation correlate with mycoplasma virulence and host adaptation?

While direct evidence linking atpF variation to virulence is limited, several lines of investigation can elucidate this relationship:

Comparative Genomics Approach:

  • Sequence atpF genes from multiple isolates of M. arthritidis with varying degrees of virulence

  • Identify non-synonymous substitutions that might affect protein function

  • Correlate specific sequence variants with virulence phenotypes

Functional Impact Considerations:

Research Design Strategies:

  • Mutagenesis Studies: Create atpF variants and assess effects on ATP synthesis, growth, and virulence

  • Transcriptomics: Compare atpF expression levels between virulent and attenuated strains

  • Host Adaptation Analysis: Compare atpF sequences from mycoplasmas adapted to different hosts

The evolutionary pattern of F₁-like ATPases in mycoplasmas, with evidence of horizontal gene transfer between species sharing the same host, suggests that adaptation of energy metabolism to specific host environments may be important for mycoplasma survival and pathogenicity .

How do the novel F₁-like ATPases in mycoplasmas differ structurally and functionally from conventional F-type ATP synthases?

Mycoplasma F₁-like ATPases represent a fascinating evolutionary innovation distinct from conventional F-type ATP synthases found in most bacteria. Key structural and functional differences include:

Structural Composition:

  • Gene Organization: While typical F₁F₀ ATPases (Type 1) are encoded by eight genes, the F₁-like ATPases (Types 2 and 3) are encoded by seven genes, with only four showing homology to conventional ATP synthase components .

  • F₁-like Components: These include proteins structurally similar to the α, β, γ, and ε subunits of typical F₁ ATPases, likely forming a comparable catalytic sector .

  • Novel Membrane Components: Instead of the conventional a, b, and c subunits forming the F₀ proton channel, F₁-like ATPases contain three unique proteins with no homology to known proteins. Two of these proteins contain multiple predicted transmembrane helices (3 and 12 respectively), suggesting they form a novel membrane-embedded structure termed the "X₀" sector .

Functional Implications:

  • Proton Translocation: The novel membrane components likely form an alternative proton conduction pathway with potentially different ion specificity or regulatory properties.

  • Energy Coupling: The mechanism coupling ion movement to ATP synthesis/hydrolysis may differ from conventional F-type ATP synthases.

  • Catalytic Efficiency: Mutagenesis and complementation studies in M. mycoides demonstrated that the Type 3 cluster is associated with a major ATPase activity in membrane fractions, confirming its functional importance .

These unique F₁-like ATPases demonstrate that despite their reductive evolution, mycoplasmas have developed novel energy-transducing complexes, possibly adapted to their specific host-dependent lifestyle .

What evidence supports horizontal gene transfer of ATP synthase components among mycoplasma species?

Phylogenomic analysis provides compelling evidence for horizontal gene transfer (HGT) of ATP synthase gene clusters among mycoplasma species:

Key Evidence:

  • Phylogenetic Incongruence: Type 3 F₁-like ATPase clusters appear in mycoplasma species belonging to different phylogenetic groups, with sequences more closely related to each other than would be expected based on the species phylogeny .

  • Genomic Context Analysis: Examination of the regions surrounding these gene clusters reveals patterns consistent with genomic integration events rather than vertical inheritance .

  • Evolutionary Origin: Both Type 2 and Type 3 clusters are believed to have originated from the Hominis group of mycoplasmas, with Type 3 clusters subsequently transferring to other phylogenetic groups .

  • Host-Associated Transfer: The pattern of distribution suggests that horizontal transfer occurred between mycoplasma species sharing the same host, providing ecological opportunity for genetic exchange .

This horizontal transfer of entire functional gene clusters represents an important mechanism for rapid adaptation in mycoplasmas, potentially allowing acquisition of optimized energy production systems suited to specific host environments. The retention and expression of these transferred genes indicate they provide selective advantages despite the general trend toward genome reduction in these organisms .

What methodological approaches can determine the role of atpF in mycoplasma pathogenesis?

Investigating the role of atpF in mycoplasma pathogenesis requires a multi-faceted experimental approach:

Genetic Manipulation Strategies:

  • Gene Knockout/Knockdown: Create atpF-deficient mutants using homologous recombination or CRISPR-Cas systems adapted for mycoplasmas

  • Complementation Studies: Restore function with wild-type or modified atpF to confirm phenotype specificity

  • Conditional Expression Systems: Control atpF expression to study effects at different infection stages

Functional Assessment Methods:

  • Growth Analyses: Compare growth kinetics in different media and under stress conditions

  • ATP Production Measurement: Quantify ATP synthesis capacity using luciferase-based assays

  • Membrane Potential Determination: Assess proton gradient maintenance using fluorescent dyes

Pathogenesis Models:

  • Cell Culture Infection: Measure adherence, invasion, and cytopathic effects on host cells

  • Animal Infection Models: Assess colonization, persistence, and disease manifestations

  • Competitive Index Assays: Co-infect with wild-type and atpF mutants to determine fitness in vivo

Host Response Evaluation:

  • Immunogenicity Analysis: Characterize antibody and T-cell responses to atpF

  • Cytokine Profiling: Measure inflammatory mediator production during infection

  • Transcriptomics: Analyze host gene expression changes in response to wild-type versus atpF-mutant infection

Researchers studying M. mycoides demonstrated through mutagenesis and complementation that Type 3 F₁-like ATPase is associated with major ATPase activity in membrane fractions, suggesting a critical role in energy metabolism that likely impacts pathogenic potential .

How can structural biology approaches enhance our understanding of mycoplasma ATP synthase complexes?

Advanced structural biology techniques offer powerful tools for elucidating the unique features of mycoplasma ATP synthases, particularly the novel F₁-like ATPases:

Cryo-Electron Microscopy (Cryo-EM):

X-ray Crystallography:

  • Advantages: Potentially higher resolution than cryo-EM; well-suited for individual domains or subunits

  • Applications: Resolve atomic details of the F₁-like component; identify catalytic residues; map interaction interfaces

  • Challenges: Crystallization of membrane proteins or large complexes is difficult; requires highly pure, homogeneous samples

Integrative Structural Approaches:

  • Cross-linking Mass Spectrometry (XL-MS): Identifies spatial relationships between subunits in the intact complex

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Maps conformational dynamics and solvent accessibility

  • Small Angle X-ray Scattering (SAXS): Provides low-resolution envelopes of protein complexes in solution

Computational Methods:

  • Homology Modeling: Create structural models of the F₁-like components based on conventional F₁ structures

  • Ab initio Structure Prediction: Apply new methods like AlphaFold2 to predict structures of the novel membrane components

  • Molecular Dynamics Simulations: Examine conformational dynamics and energy transduction mechanisms

These approaches could reveal how the unique "X₀" sector proposed for F₁-like ATPases interacts with the F₁-like components to form a functional energy-transducing complex, potentially uncovering novel mechanisms of ATP synthesis in these specialized bacteria .

How does ATP synthase research in mycoplasmas inform bacterial evolution and minimal genome studies?

ATP synthase research in mycoplasmas provides valuable insights into bacterial evolution and minimal genome biology:

Evolutionary Adaptations:
The discovery of novel F₁-like ATPases unique to mycoplasmas represents a fascinating case of evolutionary innovation in organisms typically characterized by reductive evolution. Despite possessing some of the smallest genomes among free-living organisms, mycoplasmas have evolved and maintained specialized ATP synthase variants, highlighting the critical importance of energy metabolism .

Minimal Gene Set Considerations:

  • The retention of ATP synthase genes in mycoplasmas with highly reduced genomes suggests these are part of the core essential gene set

  • The existence of alternative, streamlined ATP synthase complexes provides insights into the minimal functional requirements for ATP production

  • The diversity of ATP synthase types within mycoplasmas indicates multiple evolutionary solutions to energy generation constraints

Horizontal Gene Transfer Dynamics:
The evidence for horizontal transfer of Type 3 F₁-like ATPase clusters between mycoplasma species sharing the same host demonstrates an important mechanism for rapid adaptation and functional innovation even in minimal genomes .

Implications for Synthetic Biology:
This research informs efforts to design minimal bacterial genomes by identifying:

  • Essential components of energy-generating systems

  • Functionally equivalent alternatives to standard cellular machinery

  • Modular gene clusters that can function in different genomic contexts

What immunological insights can be gained from studying recombinant atpF in vaccine development?

Exploring M. arthritidis atpF as a potential vaccine antigen offers several immunological insights:

Antigenicity Assessment:
Studies with M. pneumoniae ATP synthase beta subunit (AtpD) demonstrated strong immunogenicity, with serum samples from infected patients showing high reactivity against recombinant AtpD while healthy donor sera showed no reactivity . This suggests ATP synthase components are prominent targets of the immune response during natural infection.

Serological Response Patterns:
The M. pneumoniae AtpD studies revealed differential antibody class responses:

  • IgM responses were particularly strong in children (70% sensitivity)

  • IgG responses showed highest sensitivity in children (78%)

  • Adult responses differed slightly, with IgA showing stronger responses than in children

These patterns could inform the timing and design of vaccination strategies targeting different age groups.

Diagnostic Value:
The high specificity (97%) observed for M. pneumoniae AtpD in ELISA tests suggests minimal cross-reactivity with other antigens, making ATP synthase components promising candidates for specific vaccine development .

Optimization Strategies:
Combination approaches using multiple antigens showed improved performance in diagnostic applications. In M. pneumoniae studies, combining AtpD with the P1 adhesin protein enhanced detection sensitivity . This suggests multi-antigen formulations might provide broader protection in vaccine applications.

Host Response Considerations:
Understanding the specific immune responses to ATP synthase components across different hosts could reveal mechanisms of protective immunity and inform adjuvant selection and vaccination protocols.

How do protein expression and purification challenges with atpF inform structural biology methods?

Working with recombinant M. arthritidis atpF presents specific challenges that have broader implications for structural biology methodologies:

Membrane Protein Expression Strategies:
ATP synthase subunit b (atpF) contains membrane-spanning domains that complicate expression and purification. Approaches developed for atpF can inform methods for other challenging membrane proteins:

  • Optimization of detergent types and concentrations for solubilization

  • Development of specialized expression hosts

  • Design of fusion constructs to enhance solubility

Protein Complex Assembly Studies:
ATP synthase components function within a multiprotein complex, requiring approaches to:

  • Express multiple components simultaneously

  • Reconstitute complexes from purified components

  • Validate proper assembly and stoichiometry

Quality Control Metrics:
Successful work with ATP synthase components requires rigorous quality assessment protocols:

  • Multi-method verification of proper folding

  • Functional validation of purified proteins

  • Stability optimization for downstream applications

Innovative Structural Approaches:
Challenges with ATP synthase components have driven methodological innovations:

  • Nanodiscs and other membrane mimetics for structure determination

  • Fragment-based approaches examining soluble domains separately

  • Cross-linking strategies to capture transient interactions

Experience with M. pneumoniae AtpD showed that proteins could be expressed in E. coli with high purity (estimated 100% by densitometry) and correct molecular mass, demonstrating that despite challenges, heterologous expression systems can successfully produce mycoplasma ATP synthase components with proper structural integrity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.